Bartonella henselae Houston-1: BH05360 Help Entry BH05360           CDS       T00180                                  Symbol acpP1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bhe  Bartonella henselae Houston-1 Pathway bhe01100   Metabolic pathways bhe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bhe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BH05360 (acpP1)    00074 Mycolic acid biosynthesis     BH05360 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BH05360 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1493 Delta_lysin Motif Other DBs NCBI-ProteinID:  CAF27344 UniProt:  Q6G442 LinkDB All DBs Position 623143..623379 Genome browser AA seq 78 aa AA seqDB search MSDTVERVKKIIVEHLGVNADKVVEDASFIDDLGADSLDTVELVMAFEEEFGVEIPDEAA ETIFTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagtagagcgcgttaagaaaattatcgtagagcatcttggggttaatgca gataaggtagtagaagatgcgagctttatcgatgatctaggagcagatagccttgatacg gtcgagctcgttatggcttttgaagaagaatttggtgtagaaatcccagatgaggctgct gaaacgattttcacagtgggtgatgcagtaaagtttattgataaagcttctgcataa

DBGET integrated database retrieval system