Bartonella henselae Houston-1: BH09720 Help Entry BH09720           CDS       T00180                                  Name (GenBank) hypothetical protein   KO K23264   phosphoribosylformylglycinamidine synthase subunit PurS [EC:6.3.5.3] Organism bhe  Bartonella henselae Houston-1 Pathway bhe00230   Purine metabolism bhe01100   Metabolic pathways bhe01110   Biosynthesis of secondary metabolites Module bhe_M00048   De novo purine biosynthesis, PRPP + glutamine => IMP Brite KEGG Orthology (KO) [BR:bhe00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     BH09720 Enzymes [BR:bhe01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor     6.3.5.3  phosphoribosylformylglycinamidine synthase      BH09720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PurS Motif Other DBs NCBI-ProteinID:  CAF27765 UniProt:  A0A0H3LWZ9 LinkDB All DBs Position 1065417..1065656 Genome browser AA seq 79 aa AA seqDB search MKARVIVTLKNSVLDPQGEAIIGALKSLSFTGIHSIRQGKVFDIVLDDQSAKNAKQTLEQ MCEELLANTVIENYTIELL NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaaagcacgcgttatagttactctcaaaaacagtgttcttgatccgcaaggggaagca attatcggtgctttaaagagtttatctttcacaggtattcactctattcgccagggaaaa gtttttgatattgtgctcgatgaccaatctgctaaaaatgcaaagcaaacacttgaacaa atgtgtgaagagctcctcgcaaatactgtcattgaaaattatacaatagaacttctttaa

DBGET integrated database retrieval system