Bartonella henselae Houston-1: BH15530 Help Entry BH15530           CDS       T00180                                  Symbol korB Name (GenBank) korB protein   KO K03746   DNA-binding protein H-NS Organism bhe  Bartonella henselae Houston-1 Brite KEGG Orthology (KO) [BR:bhe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bhe03036]     BH15530 (korB)    03400 DNA repair and recombination proteins [BR:bhe03400]     BH15530 (korB) Chromosome and associated proteins [BR:bhe03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BH15530 (korB) DNA repair and recombination proteins [BR:bhe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BH15530 (korB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Pilus_CpaD Motif Other DBs NCBI-ProteinID:  CAF28316 UniProt:  A0A0R4J8Z9 LinkDB All DBs Position complement(1802021..1802290) Genome browser AA seq 89 aa AA seqDB search MNLDELQEMRIQIDAELKKRQAKEKQNARRKILEIANAHGIDIADLVRKERHYRNPNNQW ELWNGRGRKPKWIKEWLENGYALEELEVT NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaaccttgatgagttacaagaaatgcgcatccaaattgatgcagaattgaaaaaacgg caggcaaaagagaagcagaatgcacggcgaaaaattcttgaaattgccaatgcacatgga attgatatcgctgatcttgtgcgcaaagagcgtcattatagaaatcccaataaccaatgg gaattatggaatgggcgtgggcgtaaacctaagtggattaaagaatggttggagaatggt tatgcgcttgaagaattagaagtaacataa

DBGET integrated database retrieval system