Benincasa hispida (wax gourd): 120070712 Help Entry 120070712         CDS       T07258                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism bhj  Benincasa hispida (wax gourd) Pathway bhj04136   Autophagy - other Brite KEGG Orthology (KO) [BR:bhj00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     120070712  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhj04131]     120070712    04121 Ubiquitin system [BR:bhj04121]     120070712    03029 Mitochondrial biogenesis [BR:bhj03029]     120070712 Membrane trafficking [BR:bhj04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     120070712 Ubiquitin system [BR:bhj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    120070712 Mitochondrial biogenesis [BR:bhj03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     120070712 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  120070712 NCBI-ProteinID:  XP_038878493 LinkDB All DBs Position 1:69413304..69416104 Genome browser AA seq 95 aa AA seqDB search MASTESSSSARKVVVLLRATGDAPILKQTKFKMPGTDKFIKVIDYIRRSIQRDTLFVFVN SAFSPGPDETVIDLYNNFGIDGKLVVNYACSMAWG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcttctacagagtcgtctagttctgctcgaaaagtggttgtcctgctgagagctact ggggatgctcctattctcaaacaaaccaagtttaagatgcccggaacagacaaatttatt aaagttattgattatatacgccggtcaattcaacgggacaccttgtttgtgtttgtcaac agtgcattctcaccaggtccagatgagacagttattgatctatataataactttggaatt gatgggaaattggttgtaaattatgcctgctcgatggcttggggctaa

DBGET integrated database retrieval system