Benincasa hispida (wax gourd): 120071162 Help Entry 120071162         CDS       T07258                                  Name (RefSeq) protein MHF2 homolog isoform X1   KO K15360   centromere protein X Organism bhj  Benincasa hispida (wax gourd) Pathway bhj03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:bhj00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     120071162  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:bhj03400]     120071162 DNA repair and recombination proteins [BR:bhj03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      120071162 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  120071162 NCBI-ProteinID:  XP_038879195 LinkDB All DBs Position 2:10983214..10984908 Genome browser AA seq 103 aa AA seqDB search MEENAFHPDLIHAIFKLEWSRRSLEREKNENPDAMDCEVDAGTSKKSRPMSANANALKLS SKLVQIFVSEAVQRAATIAEAEGINRIEATHLERILPQLLLDF NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggaagagaacgcatttcatcctgatctgattcacgccatcttcaagctcgagtggagc agaagatcacttgagcgcgagaaaaatgagaatccggatgctatggattgtgaggttgac gctggaacatccaagaagagcaggccgatgtcagccaatgcaaatgctcttaaattgagc tctaaacttgtacaaatttttgtctcagaggctgtgcagcgcgctgcaacaattgctgaa gcagaaggtattaacagaattgaagccactcatttggagagaattcttccgcagttacta ctggatttttga

DBGET integrated database retrieval system