Benincasa hispida (wax gourd): 120076455 Help Entry 120076455         CDS       T07258                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bhj  Benincasa hispida (wax gourd) Pathway bhj04145   Phagosome bhj04148   Efferocytosis bhj04620   Toll-like receptor signaling pathway bhj05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bhj00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     120076455    04148 Efferocytosis     120076455  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120076455  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     120076455  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhj04131]     120076455   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bhj04147]     120076455    04031 GTP-binding proteins [BR:bhj04031]     120076455 Membrane trafficking [BR:bhj04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     120076455  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     120076455   Macropinocytosis    Ras GTPases     120076455  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     120076455 Exosome [BR:bhj04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120076455   Exosomal proteins of other body fluids (saliva and urine)    120076455   Exosomal proteins of colorectal cancer cells    120076455   Exosomal proteins of bladder cancer cells    120076455 GTP-binding proteins [BR:bhj04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     120076455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  120076455 NCBI-ProteinID:  XP_038886218 LinkDB All DBs Position 4:complement(3171806..3174908) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIVLVGTKL DLRDDKQFFVDHPGAVPISTVQGEELRKVIGAPAYIECSSKTQQNVKGVFDAAIKVVLQP PKSKKKKKKSQNVCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtccaggtttataaagtgcgtaacggttggtgatggtgctgtgggtaaaacc tgtatgttgatttcctatacgagtaacactttccccacggactacgtgcctaccgttttt gacaatttcagtgccaatgtggtggttgatggaagcacggtcaacctaggattatgggat actgctggtcaagaggattacaatagattaagaccactaagctatagaggtgctgatgtt tttattcttgctttctctctcataagcaaggccagctatgaaaatgttgccaagaagtgg attcctgaattgagacattatgcacctggtgttccaatagttcttgttggaactaaactt gatcttcgggatgacaagcagttctttgtagaccaccctggtgcagtacccatttccact gttcagggagaggagttgagaaaagttattggagccccggcatacatcgagtgtagttca aaaacccagcagaatgtgaaaggagtgttcgatgcagccattaaagtggtgctccagccg ccgaagtctaagaagaagaagaagaagtcacagaatgtctgttccatcttatga

DBGET integrated database retrieval system