Benincasa hispida (wax gourd): 120076461 Help Entry 120076461         CDS       T07258                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism bhj  Benincasa hispida (wax gourd) Pathway bhj03083   Polycomb repressive complex bhj04120   Ubiquitin mediated proteolysis bhj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bhj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120076461    04120 Ubiquitin mediated proteolysis     120076461   09126 Chromosome    03083 Polycomb repressive complex     120076461  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhj04131]     120076461    04121 Ubiquitin system [BR:bhj04121]     120076461    03036 Chromosome and associated proteins [BR:bhj03036]     120076461 Membrane trafficking [BR:bhj04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     120076461 Ubiquitin system [BR:bhj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      120076461    Cul7 complex      120076461 Chromosome and associated proteins [BR:bhj03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      120076461   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      120076461 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  120076461 NCBI-ProteinID:  XP_038886225 LinkDB All DBs Position 4:3009563..3011558 Genome browser AA seq 157 aa AA seqDB search MSSGRKITLKSSDGEIFEVDEAVALESQTIKHMIEDDCADSGIPLPNVNSKILSKVIEYC KKHVESPKPEDRTGSVDDDLKTWDSEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVAD MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtcttctggccggaaaattaccttgaagagctccgacggcgagatctttgaggtcgac gaagcggtggccttggagtctcagaccatcaagcacatgattgaagacgattgcgccgat agtggaatcccccttcctaacgtcaacagcaagatcttgtccaaggttatcgagtactgc aagaagcacgtcgagtcccctaagccggaggatcgtactggctccgtcgacgacgacctc aagacttgggacagcgaattcgtcaaagtcgaccaggctaccttattcgatctcattctg gctgcaaactatctcaacatcaaaagcttgcttgatctgacttgtcagacagtggcagac atgatcaaggggaagactcctgaggagatccgtaagacatttaacatcaagaacgacttt acgcccgaggaagaagaggaggttcgtagggagaaccaatgggcctttgaataa

DBGET integrated database retrieval system