Benincasa hispida (wax gourd): 120082555 Help Entry 120082555         CDS       T07258                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism bhj  Benincasa hispida (wax gourd) Brite KEGG Orthology (KO) [BR:bhj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:bhj03041]     120082555   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bhj04052]     120082555 Spliceosome [BR:bhj03041]  Complex B   Other components    Complex B specific factors     120082555 Cytokines and neuropeptides [BR:bhj04052]  Neuropeptides   Unclassified    120082555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Motif Other DBs NCBI-GeneID:  120082555 NCBI-ProteinID:  XP_038893706 LinkDB All DBs Position 8:6686470..6740520 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNGDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctcaacgatcgtctcgggaagaaggtccgggtgaagtgcaacggg gacgatacgatcggcgacttgaagaagctcgtcgccgctcagaccggaaccagggccgag aaaatcaggatccagaagtggtacaacatctacaaggatcatatcactcttaaagattac gagatccatgacggcatggggctggaactctattacaattga

DBGET integrated database retrieval system