Benincasa hispida (wax gourd): 120083068 Help Entry 120083068         CDS       T07258                                  Name (RefSeq) sm-like protein LSM1B   KO K12620   U6 snRNA-associated Sm-like protein LSm1 Organism bhj  Benincasa hispida (wax gourd) Pathway bhj03018   RNA degradation Brite KEGG Orthology (KO) [BR:bhj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     120083068  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bhj03019]     120083068 Messenger RNA biogenesis [BR:bhj03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      120083068   mRNA degradation factors    5'-3' decay     Lsm complex      120083068 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Mbeg1-like Motif Other DBs NCBI-GeneID:  120083068 NCBI-ProteinID:  XP_038894529 LinkDB All DBs Position 1:71885354..71888391 Genome browser AA seq 95 aa AA seqDB search MRSFDQFGTIVLESAFERIIVENEYCDNPIGLLVVRAENIILIGEPDPSLPQLPPHMTVV SLPQILTARKAERESVELQRTLKKWMEELLEDIFD NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcgttcctttgatcaatttgggactattgttcttgaaagtgcttttgaaagaattatt gttgagaatgagtattgtgataatcccattggtcttttggtagttcgagccgagaatatt attctaattggagagccggaccccagcttgcctcaacttcctccacatatgactgttgtc tctctccctcagattctaactgctaggaaagcagaaagggagtcagtagagcttcaaaga accttgaagaaatggatggaggaactccttgaagatatatttgattga

DBGET integrated database retrieval system