Benincasa hispida (wax gourd): 120089796 Help Entry 120089796         CDS       T07258                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism bhj  Benincasa hispida (wax gourd) Pathway bhj03083   Polycomb repressive complex bhj04120   Ubiquitin mediated proteolysis bhj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bhj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120089796    04120 Ubiquitin mediated proteolysis     120089796   09126 Chromosome    03083 Polycomb repressive complex     120089796  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhj04131]     120089796    04121 Ubiquitin system [BR:bhj04121]     120089796    03036 Chromosome and associated proteins [BR:bhj03036]     120089796 Membrane trafficking [BR:bhj04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     120089796 Ubiquitin system [BR:bhj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      120089796    Cul7 complex      120089796 Chromosome and associated proteins [BR:bhj03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      120089796   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      120089796 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  120089796 NCBI-ProteinID:  XP_038903121 LinkDB All DBs Position 11:complement(6946271..6948545) Genome browser AA seq 155 aa AA seqDB search MSSSKKITLKSSDGDSFEVDEAVALQSQTIRHMIEDDCADNGIPLPNVTSNILAKVIEYC RKHVDASSADPRLSDDDLKAWDRDFVNVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcttcctccaagaagatcactctcaagagctccgatggcgactctttcgaagtcgat gaggccgttgccctccaatctcagaccatccgccacatgatcgaggacgattgcgccgat aacggcatccctcttcccaacgtcaccagcaatatcctcgctaaagtcatcgagtactgc cgtaagcacgtcgatgcttcctctgccgatccccgtctctccgatgacgatctcaaggcc tgggaccgcgacttcgttaatgtcgaccaagccactcttttcgatctcattctggctgca aattatctgaacatcaagagcttgttagaccttacatgtcaaactgtagcagacatgatc aagggaaagaccccggaggagatccgaaagacctttaacatcaagaacgacttcacaccg gaggaggaggaggaagttcgtagggagaatcagtgggcttttgaatga

DBGET integrated database retrieval system