Benincasa hispida (wax gourd): 65340000 Help Entry 65340000          CDS       T07258                                  Symbol atpH, KQ636_pgp077 Name (RefSeq) ATP synthase CF0 subunit III   KO K02110   F-type H+-transporting ATPase subunit c Organism bhj  Benincasa hispida (wax gourd) Pathway bhj00190   Oxidative phosphorylation bhj00195   Photosynthesis bhj01100   Metabolic pathways Module bhj_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:bhj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     65340000 (atpH)    00195 Photosynthesis     65340000 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:bhj00194]     65340000 (atpH) Photosynthesis proteins [BR:bhj00194]  Photosystem and electron transport system   F-type ATPase [OT]    65340000 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  65340000 NCBI-ProteinID:  YP_010131081 UniProt:  A0A7T3QP16 LinkDB All DBs Position CP Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctgggttggccgtcgggcttgct tctattggacctggggttggtcaaggtactgctgcgggccaagctgtagaagggatcgcg agacaacccgaggcggagggaaaaatccgaggtactttattgcttagtctggcttttatg gaagctttaactatttatggactggttgtagcattagcacttttatttgcgaatcctttt gtttaa

DBGET integrated database retrieval system