KEGG   Sutcliffiella horikoshii: B4U37_06975
Entry
B4U37_06975       CDS       T04904                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bhk  Sutcliffiella horikoshii
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bhk03000]
    B4U37_06975
Transcription factors [BR:bhk03000]
 Prokaryotic type
  Other transcription factors
   Others
    B4U37_06975
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2 ABC2_membrane_3
Other DBs
NCBI-ProteinID: ART75787
UniProt: A0A1Y0CLK0
LinkDB
Position
1344090..1345043
AA seq 317 aa
MKKSLMVVILFILLLTACGQTTPESGDQKVGLLVPDTISDQVWGTKGYKGLLRIQTEYDL
DVYYKEGIHTATSIKDAVKEFDKDEVTLVFGHGSEYAQTFNEISSDYPDIHFVCFNSQVQ
GDNVTSLNFEAHAMGFFGGMVAGHMTETNTIGILAAFEWQPEVDGFFEGALYENPDAEII
IEYTQDWNDPDKALEVLDSMIDQEVDVVYPAGDGYNVPVINSLKEQGLYAVGFVSDQSDL
GENTVLTSTIQHVPALYELVASRFFAGELESGNLSFDFKDDVISLGTFSPLVSEEYQASI
NQQIEDYKSTGLLPNEK
NT seq 954 nt   +upstreamnt  +downstreamnt
atgaaaaaatcattaatggtagtcatactatttattcttttattaactgcatgtggacaa
actactcctgaaagcggagatcaaaaggtcggcttgttggtccctgatacgataagtgat
caagtatggggaacaaaaggctataaagggctgttgcggattcaaacggaatatgacctg
gatgtatattataaagaaggcatacatactgctacatcgattaaagatgcggtgaaagag
tttgataaagacgaagttaccttggtatttgggcatggcagcgaatatgctcagacattc
aatgagatatcatctgattatcctgacatccattttgtatgttttaattcccaagtacaa
ggggacaatgtaacaagtttgaattttgaagcacatgccatgggctttttcggtggaatg
gtagctggccatatgacggagactaatactattggaattttagccgcatttgaatggcag
cctgaagtggacggattcttcgaaggggcattatatgaaaatcccgatgctgaaattata
atagagtacactcaagactggaatgatcctgataaggcattggaagtgcttgacagtatg
atcgatcaagaggtggatgttgtgtatcctgctggtgacggatataatgtacctgtcatc
aatagtctaaaggaacaagggctctatgcggtaggattcgtctctgatcagtccgactta
ggagagaatactgtacttaccagtaccatacagcatgtccctgccttgtatgaattggta
gccagtcgtttctttgcaggggaattagaatctggtaacctttccttcgattttaaagat
gatgtcatatcactcgggacattcagtccgctagtaagcgaggaataccaggctagcatt
aatcaacaaatcgaggattataagtctaccggtttattaccaaacgaaaaatag

DBGET integrated database retrieval system