Sutcliffiella horikoshii: B4U37_11080 Help Entry B4U37_11080       CDS       T04904                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bhk  Sutcliffiella horikoshii Pathway bhk00975   Biosynthesis of various siderophores bhk01100   Metabolic pathways bhk01110   Biosynthesis of secondary metabolites Module bhk_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:bhk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     B4U37_11080  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bhk01008]     B4U37_11080 Polyketide biosynthesis proteins [BR:bhk01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     B4U37_11080 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ART76547 UniProt:  A0ABN4ZJA8 LinkDB All DBs Position complement(2147385..2147666) Genome browser AA seq 93 aa AA seqDB search MLNREELYQAVYDILKHKLEIPTWKSFEENARLNEDLYMDSIMILQLILHLELDLGLNIP DDMFVPKDFHTVETLLNFLEELSKNSYEKERHV NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgagaagagctttatcaggctgtgtacgatatattgaaacataaattagaa ataccaacatggaagtctttcgaagagaacgcaagattgaatgaagatttgtatatggat tccattatgattctacaacttattttacatttagagttggatttgggtctaaatatcccg gatgacatgtttgtgccaaaggacttccatactgttgaaacattattgaactttttggag gagttgtccaagaactcttatgaaaaggagagacacgtatga

DBGET integrated database retrieval system