Bacteroides helcogenes: Bache_2870 Help Entry Bache_2870        CDS       T01393                                  Name (GenBank) putative ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bhl  Bacteroides helcogenes Pathway bhl00020   Citrate cycle (TCA cycle) bhl00720   Other carbon fixation pathways bhl01100   Metabolic pathways bhl01110   Biosynthesis of secondary metabolites bhl01120   Microbial metabolism in diverse environments bhl01200   Carbon metabolism bhl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bhl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Bache_2870   09102 Energy metabolism    00720 Other carbon fixation pathways     Bache_2870 Enzymes [BR:bhl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Bache_2870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_6 Fer4_7 Fer4_10 LdpA_Fe-S-bd Fer4_4 Fer4_9 Fer4_16 Fer4_15 Fer4_8 Fer4_22 Fer4_17 Fer4_20 DUF5651 Fer4_3 Fer4_13 DUF2284 Motif Other DBs NCBI-ProteinID:  ADV44805 UniProt:  E6SNS2 LinkDB All DBs Position 3416605..3416832 Genome browser AA seq 75 aa AA seqDB search MAKVKGAIVVDTERCKGCNLCVVACPLKVIALAKEVNMKGYNYAQQIIEDTCNGCSSCAT VCPDGCISVYKVKVE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagtcaaaggagcaatcgttgtggacactgagcgttgcaagggctgcaacctg tgcgtggtagcttgtccgcttaaggtaatagccctcgccaaagaggtaaatatgaaaggg tataattatgcccagcaaataatagaagatacatgcaacggatgttcatcctgtgcaacc gtatgtcctgacggatgtatctccgtatataaggtaaaagttgaataa

DBGET integrated database retrieval system