Bordetella holmesii 44057: D558_0036
Help
Entry
D558_0036 CDS
T03379
Symbol
dctA
Name
(GenBank) C4-dicarboxylate transport protein
KO
K11103
aerobic C4-dicarboxylate transport protein
Organism
bhm
Bordetella holmesii 44057
Pathway
bhm02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
bhm00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
D558_0036 (dctA)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bhm02000
]
D558_0036 (dctA)
Transporters [BR:
bhm02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
D558_0036 (dctA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SDF
Motif
Other DBs
NCBI-ProteinID:
AIT24737
LinkDB
All DBs
Position
complement(32350..33150)
Genome browser
AA seq
266 aa
AA seq
DB search
MTDFLTVLSLPVFKLVALLMKAAPIGAFGAMAFTIGKYGIKSVVNLAMLVGTFYVTSILF
VVVVLGLVARYNGFSILKLVRYIREELLLVLGTSSSEAALPTLMQKMERAGCSKSVVGLV
VPTGYSFNLDGTNIYMTMAALFIAQACDIPLTLGDQILLLLVAMLSSKGAAGVTGADFIT
LAATLSVVPTVPVAGMALILGVDRFMSECRALTNLVGNATASIVVARWEGELDKDALQVA
LEGSRAAPAAEQAKQAKQAKQAKQAG
NT seq
801 nt
NT seq
+upstream
nt +downstream
nt
gtgacggattttctgacggtcctgtcgttgccggttttcaagctggttgcgctgttgatg
aaggctgcacccattggcgccttcggcgccatggcttttacgataggcaaatatggcatc
aagtccgtggtcaacctggcgatgctggtaggaaccttctacgttacctcgatattgttc
gtggttgtggtcctggggctggtggcgcgttataacggtttttccatcctgaaactggtg
cgttatatccgcgaagagctcctgctggtgttgggtacgagctcgtcggaggcggcgctg
cccacgctgatgcaaaaaatggagcgcgccgggtgttcgaaatccgtggtgggcctggtc
gtgccgacgggctactccttcaacctggatggaaccaacatctatatgaccatggccgcg
ttgtttatcgcacaggcttgtgacattccgcttacgttgggcgatcagatcctgctgctg
ttggtggcgatgctgagttccaagggggccgcgggcgtgacgggtgcggacttcattacg
ctggcggccacgttgtcggtggtcccgactgtcccggtggcgggtatggccttgattctg
ggggtcgaccgtttcatgtctgaatgccgtgcgctgaccaatctggtgggcaacgctacc
gcctcgattgtcgtggcgcgttgggaaggcgagttggacaaggatgccctgcaggtggcg
ctcgagggttcacgtgctgcgccggctgccgaacaggccaagcaggccaagcaggccaag
caggccaagcaggcaggttaa
DBGET
integrated database retrieval system