Bordetella holmesii 44057: D558_1832 Help Entry D558_1832         CDS       T03379                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bhm  Bordetella holmesii 44057 Pathway bhm00190   Oxidative phosphorylation bhm01100   Metabolic pathways bhm02020   Two-component system Module bhm_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bhm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     D558_1832  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     D558_1832 Enzymes [BR:bhm01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      D558_1832 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AIT26502 LinkDB All DBs Position 1728055..1728180 Genome browser AA seq 41 aa AA seqDB search MWYFSWILGLGLACAFAILNAMWFELREGHAHDPFRRPADE NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttctcgtggattctcggcctgggcctggcctgcgcctttgccattctcaat gcaatgtggtttgaactgcgcgagggccatgcccacgatccgttcagaaggccggccgac gagtga

DBGET integrated database retrieval system