Bordetella holmesii 44057: D558_2289 Help Entry D558_2289         CDS       T03379                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bhm  Bordetella holmesii 44057 Pathway bhm00998   Biosynthesis of various antibiotics bhm01100   Metabolic pathways bhm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bhm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D558_2289 (acpP)    00074 Mycolic acid biosynthesis     D558_2289 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D558_2289 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 Ribosomal_L50 HLH EutQ Motif Other DBs NCBI-ProteinID:  AIT26950 LinkDB All DBs Position 2157954..2158193 Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAIDYINSNGKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgtgaacgaa gccgagatcaagaacgagtcctccttccttgacgacctcggtgccgattcgctcgacatg gtcgagttggtcatggccctcgaagacgagttcgagaccgagatccccgacgaagaggct gaaaagatcacgaccgttcaacaagcgattgattacatcaattcgaacggtaagcagtaa

DBGET integrated database retrieval system