KEGG   Bacillus halotolerans: DIC78_06305
Entry
DIC78_06305       CDS       T06619                                 
Name
(GenBank) sugar ABC transporter permease
  KO
K25677  pectin-derived oligosaccharide transport system permease protein
Organism
bht  Bacillus halotolerans
Brite
KEGG Orthology (KO) [BR:bht00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bht02000]
    DIC78_06305
Transporters [BR:bht02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Pectin-derived oligosaccharide transporter
    DIC78_06305
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AZV48676
UniProt: A0A9Q4ELF4
LinkDB
Position
complement(1245275..1246204)
AA seq 309 aa
MTGNGADRMKISRSMRKDNLAGYAFISPFIIGFFCFTVIPMGASLFLSFTSYDLFTAPKW
IGLDNYKEMFTGDEKYWQSLKVTFTYVLAGVPLRLGFALFIAVILNNAAKGTAIYRTLFY
LPSIIGGSVAVAIMWRNIFGNDGVINALLFFVGIDQKILWYQDPTSALWTLILLSVWQFG
SSMLIFLAGLKNIPASYLEAASVDGANRVQRFFRITLPMLTPIIFFNLVMQTISAFMTFT
PAYIISKGEGGPLDGTLLYSLYLFQRAFNYFQMGYASAMAWIMLIIVGLITLILFKTSSY
WVHYESKEE
NT seq 930 nt   +upstreamnt  +downstreamnt
ttgacgggaaatggggctgacagaatgaaaataagccggagtatgagaaaagacaatctg
gcgggatatgcttttatttctccgtttattatcggcttcttctgttttacggtgattccg
atgggcgcgtccctgtttctgtcctttacaagctacgacttgtttacggcgccgaaatgg
atcgggctcgataactataaggaaatgtttacgggtgacgaaaagtattggcagtcgctg
aaggtcactttcacgtatgtgcttgccggggttccgctccgcctcggcttcgcgcttttt
attgccgtcattttaaacaatgcggcaaaggggacggctatctacaggacgctgttttat
ctgccttctatcatcggcggaagtgtggctgttgccattatgtggcgcaatattttcggc
aatgacggggtcatcaatgcgctgctgttttttgtcgggatcgatcaaaaaattctctgg
taccaagacccgacaagcgcgttatggacgctgattctgctgtccgtctggcagtttggg
tcatccatgctgatttttctggccgggctgaaaaacattccggcatcgtacttggaggcg
gccagcgtggacggcgcaaaccgcgtgcagcgcttctttaggatcacgcttccgatgctg
acgccgattattttctttaacctggtcatgcagacgatttctgcttttatgacctttacc
ccagcctatatcatctcaaaaggcgagggcggtccgcttgacgggacgctattgtattca
ctctatttgttccagcgggcgtttaactattttcaaatgggctacgcctcggcgatggcg
tggatcatgctgatcattgtcgggctgattacgctgattttatttaaaacatcatcatat
tgggttcactacgaatcaaaggaggaataa

DBGET integrated database retrieval system