Bacillus halotolerans: DIC78_17325 Help Entry DIC78_17325       CDS       T06619                                  Symbol zapA Name (GenBank) cell division protein ZapA   KO K09888   cell division protein ZapA Organism bht  Bacillus halotolerans Brite KEGG Orthology (KO) [BR:bht00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bht03036]     DIC78_17325 (zapA) Chromosome and associated proteins [BR:bht03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DIC78_17325 (zapA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapA Mu_Gam-Sipho_Gp157-TOTE OGG_N Motif Other DBs NCBI-ProteinID:  AZV50621 UniProt:  A0A9Q2LIU6 LinkDB All DBs Position 3370886..3371143 Genome browser AA seq 85 aa AA seqDB search MSDGKKTKTTVDIYGQHFTMIGEESRAHMRYVAGIVDDKMREINQKNPYLDINKLAVLTA VNVVHDYVKLKEQYEKLERQLKEKD NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ttgtctgacggcaaaaaaacgaaaacaaccgttgacatttacggccagcacttcactatg atcggtgaagaaagcagagcccatatgagatatgtggccggaattgttgatgataaaatg agagaaattaatcaaaaaaatccatatcttgatataaataaacttgcagtgctgacagcg gtaaatgtggtgcatgactatgtgaaattaaaagagcaatatgaaaaactggagcgtcag cttaaagaaaaggattga

DBGET integrated database retrieval system