KEGG   Bacillus halotolerans: DIC78_21510
Entry
DIC78_21510       CDS       T06619                                 
Name
(GenBank) non-ribosomal peptide synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bht  Bacillus halotolerans
Pathway
bht01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bht00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    DIC78_21510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bht01008]
    DIC78_21510
Polyketide biosynthesis proteins [BR:bht01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    DIC78_21510
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Transferase RHH_1
Other DBs
NCBI-ProteinID: AZV51365
LinkDB
Position
4139877..4147541
AA seq 2554 aa
MPQQPEIQDIYPLSFMQEGMLFHSLYDEQSRAYFEQASFTINGQLDLDRFQKSMDAVFDR
YEIFRTTFIYKNVAKPRQVVLKNRPCHVHFEDISHLNEREKEHCTEAFKEQDKKRGFDLQ
SDVLMRISVLKWAPERYVCIWSHHHILMDGWCLGIIIKDFLHIYQALGEGRLPYLQPVQP
YGTYIKWLMQQEREEAAAYWKKRLQHFEKASSLPKRNEQVSEGELQQVTFTISEKETSDL
QKIAAASGATLNTVFQALWGILLQKFNRCDDAVFGSVVSGRPSGLEDVENIVGLFINTIP
IRVQSKALSFSGLVSRLQKEMTEAEAYSYFPLYDIQAQSALKQELIDHIIVFENVPTQQE
IEGLNQTGSFGFSVENFAMAEETNYGCSVKVIPGRTLFVRINFHTGLYEPGIMAEIKDYL
QHMISAVISDPSLPVSKMTLLDKDKTQKMVAEYNTTGAVSALASTLHGLFERQAALTPDR
TALRFSGGSLTYAQLDMYANRLAARLTAHGVTKESIVGVLSERSPDMLTAVLAVLKAGGA
YLPLDPAYPEERLSYMLKDSGAALLLTQPGLKIPGFSGKTLEVDMTALANEESEYHSLHQ
ADSDSLAYVIYTSGSTGRPKGVAVEHRQAVSFLTGMQMQFPLEEDDIIMMKTSFSFDASV
WQLFWWTLSGASAYLLPSGWEKDPALMVKAIREEGVTTAHFIPAMLNSFLDQAEIEAPRS
LKRVFAGGEPLAPHTAARFASLLPETSLVHGYGPTEATVDAAFYACNPELDKDRLRLPIG
NPVPGARLYVLDPHLAVQPVGVAGELYIAGAGVARGYLNRPELTEERFLDDPFYPGERMY
KTGDLARWLPDGQVEFLGRLDDQVKIRGYRIEPGEIEAALRSIEGVREAAVTVRTESGEA
ELCAYAEGLGRNEVRKQLEALLPGYMIPAHIIEMEQWPVTPSGKLDRKALPAPDGAADRE
TYTAPTNLTEMKLSQLWEEVLKSGPVGIHDNFFDRGGHSLKATALVSRIAKEFGVQVPLR
DVFAHPTVEGLASVISEGTESPYEAMKPAEKRETYPVSSAQKRMYVLQQLEDGGTGYNMP
AVLELEGKLDLTRMEAVFKKLIKRHESLRTSFTTDTGGEPVQRIHDEVPFTFHTSVLGGQ
TEQEAAAAFIQPFDLSQAPLFRVGIVKVPDGRHLLLVDMHHIISDGVSVNTLIREFGELY
ANQELPPLHIQYKDYAVWQEAFKKGDTYKTQEAYWLKQLEGELPVLDLPADYARPPVRSF
AGDQVSFTLDQELTAGLHKLARKNGSTLYMVLLAAYTALLSRLSGQEDIIVGSPIAGRPH
KDLEPILGMFVNTLALRTRPEGGKPFAQFLQEVRETALEAYEHQDYPFEELVDKLGMTRD
MSRNPLFDVMFVLQNMDQESMQLKDLCLRPATNVEHQVSKFDLTLYAYEEANGSMMFQME
YSTDLYQKNTIEMWLQYLMNMLRAIIQDSEAALGTIHVLDENETHFLIHELNCTKREYPR
HETISRLFELQAAQTPDAIAVAGDEQTLTYKELNIRANRIAAVLRRKGVGPETVVALLTT
RTPELAAGMLGILKAGGAYLPIAKDLPPDRISYMLSDSGAKILLQSEKANNQRLDLELTC
EQIVIEEIQGQGETKNFESQAGPHSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSNYIE
FTPGDRLLLTSSLGFDVVTFEILGPLLNGAALHLTDKETFLDSHQLKRYIEQNGITTMWL
TASLFNHLTEQNEKIFSRLINLIIGGEALSASHVNRIKQACPELSIWNGYGPTENTTFST
CFHIEKLYEHSIPIGRPIGNSTAFILNKWGMLQPIGAVGELCVGGDGVARGYLGRPDLTK
EKFVPNPFAPGEQMYRTGDLARWLPDGTIEYVGRVDDQVKIRGYRVELGEIESALRHIDG
VKEAAVLARTGQLGSKELYAYISVKEGTDAEQVRTHLSQMLPGYMMPAYVIEMDALPLTA
NGKLNRKALPEPDITSKQTYVPPRNDLEEQLAIIWQEVLGTQRIGIEDSFFELGGDSIKA
LQVSARLGRYGWSLHASDLFRHPNIKDLSAVIRKTERVIDQGSVQGAVPWTPIQHWFLSQ
DIEDRHHFNQSVMLFSPDCLSENALRASLKKLAEHHDALRMIYRDDSGQQIQINQDIHES
KLYSLRISDFSDPGIDWETSIKEEVANLQQSINLQQGPLLHAAWFKTLSGDYLFLTIHHL
VVDGVSWRILLEDLSAAYHQAASGQAIQLPPKTDSYQEYARRIQDYAQSSKLIREETYWR
TVEEEKAAELPYEMPYMENMNSSVRETLRFSLTEADTAVLLQKVNHAYGTDTQDILLTAA
SLAICDWTGGSKLRMAMEGHGREHILPDLDISRTVGWFTSIYPVLIDFENQADELGTAVK
TVKDTLGRIPNKGVGYGMLKYLTHPEHKSMVFSKTPEIGFNYLGQFNDIESQDRFRPSGL
GSGKDITPTWKREQLIEMSAMAAENQLHFQLSYPPARFHRGTMERLITMIECYLRDIMKH
CAEKQNTEKTLSDFSSQSLTAEDLDSISSLVEDL
NT seq 7665 nt   +upstreamnt  +downstreamnt
atgccgcagcaacccgaaatacaggatatatatcccttgtcttttatgcaggaggggatg
ctttttcattcgctgtatgatgaacagtcgagagcttattttgaacaggcgtcttttaca
atcaatgggcagcttgacttagaccgtttccagaaaagtatggacgctgtttttgacagg
tatgaaatctttcgaacgacttttatctacaaaaatgtagccaaacctcgtcaggtggtg
cttaaaaaccgtccttgccatgttcattttgaagatatttctcatcttaatgagagagag
aaagaacattgtacagaagcattcaaggaacaagataaaaaaaggggctttgatcttcag
tcggatgtactgatgagaatatccgttttaaaatgggcgcctgagcgttacgtgtgcatc
tggagccatcaccatattttaatggacggatggtgcttaggcatcatcattaaagacttt
ctccacatttatcaagcgctgggagaagggcggcttccatatttgcagccagttcagccg
tacggaacgtatattaaatggctgatgcagcaggaacgtgaagaggcagctgcgtattgg
aaaaagcggctgcagcatttcgagaaagcttcttctttgccaaaaagaaacgagcaagta
tcagaaggtgaattacagcaggtcacgtttaccatctctgaaaaagaaacgtccgatttg
cagaaaatcgcagcagcatccggtgcaacgcttaacaccgttttccaagctttgtggggg
attttgctgcaaaaattcaatcgctgtgacgatgccgtgttcggatcagtcgtctcaggc
aggccctctgggctggaggatgtagaaaatatagtcggcctttttatcaataccattccc
atccgggtccaaagcaaagctctttctttctctggcctggtcagccggctgcaaaaggaa
atgactgaagcagaagcatacagttatttccctctatatgacattcaagcacagagtgct
cttaaacaagagctcattgatcatattatcgtgtttgaaaacgtgccgacccagcaagaa
attgaaggactaaaccagactggatcgttcggtttctcagtggaaaactttgcgatggcg
gaggagactaattatggatgcagcgtcaaagtgattccaggccgcacattgttcgtgcgc
atcaattttcatacaggtttatatgagcctggcataatggctgagataaaagattattta
cagcatatgatttcagctgtcatctctgatccttctcttcctgtttcaaagatgacgtta
ctagataaagacaaaacacagaaaatggttgctgaatataatacgacgggagctgtttca
gcgttagcttcgacgctgcacggtctgtttgaacgccaggcggctttgacgccggatcgg
acggccttacgcttttctggcggttcgctgacttacgcgcagcttgacatgtacgccaac
aggctggcagcgcgccttacggcgcatggtgtcacgaaggaaagcattgtcggtgttcta
agcgagcgttcaccggacatgctgacagccgttctcgccgtattaaaggcaggcggagct
tatttgccgcttgatcctgcatatccagaggagcggctgagctatatgctgaaagacagc
ggggcagcattgttgctgacgcagccaggattaaagatacctggtttttccggaaagaca
cttgaagtggatatgacggctcttgcgaatgaagaatctgaatatcactctcttcatcaa
gcggacagcgattctctcgcctacgtgatctatacgtcgggctccactggacggccgaaa
ggggtcgccgtggagcaccgccaggctgtttcctttctgaccggcatgcagatgcagttt
cctttagaggaagacgacatcattatgatgaaaacgtctttttcctttgatgcatctgtc
tggcagctgttttggtggacgctttcaggtgcttcggcctatctgcttccgtccggctgg
gagaaagatccggcattgatggtaaaagccattcgagaggaaggcgttacaacggcccat
tttattccggccatgctgaacagctttttggatcaagcggaaatagaggcaccgagaagc
ctgaagcgcgtattcgccggaggtgaaccgctggcaccccatacggcagcccgtttcgct
tctttgctgccggagacatcactggtccacggctacgggccgacagaagcaaccgttgat
gcggcattttacgcgtgtaatcctgagctggacaaggatcgcttgcgccttccgatcgga
aaccccgtgcctggcgcgcgtctgtatgtgttagatcctcatttagccgtacagcctgtc
ggcgtagcgggagaattgtatatcgccggagccggggttgccagaggctacttgaatcgt
ccggaattaacagaagaacgttttcttgatgatccattttatccgggtgaacgcatgtac
aaaacgggtgatttggcgcgctggctgccagatggacaagttgaattcctcggccgtctg
gatgaccaggtgaaaatccgcggctaccggattgagccgggagaaatcgaagcggcgctc
agaagcatagaaggcgtgcgggaagcggctgtaactgttcgtacagaaagcggcgaggcg
gaattatgtgcatatgcggaagggctcggaagaaatgaagtgcgcaagcagcttgaggca
ttgctgccgggctatatgattcctgctcatatcattgaaatggaacaatggccggttacc
ccgagcggaaagctcgaccgaaaagcgctgcctgctcctgacggagcggcagatcgggaa
acctacacagcgccgacaaacctgacagagatgaagctttcccagctgtgggaggaagtg
ctgaaaagcggacctgtcggcattcacgacaacttttttgaccggggcggccattcctta
aaagccaccgcgcttgtctcccggatcgccaaggaattcggcgtccaagtgccgctgagg
gatgtgtttgcccatccgacggtagaaggtttggcttctgtcatcagcgaaggaacggaa
agtccgtatgaagccatgaagccggctgaaaaacgcgagacctacccggtttcctccgcc
caaaagcggatgtatgtgctccagcagctggaggatggaggcacaggctacaatatgccg
gcagtcttggagctggaaggaaagctggatcttacaagaatggaggccgtattcaaaaag
ctgatcaaacgccacgagtcactgcgcacgtcctttacaacggacacaggcggcgagccg
gttcagcgcatccatgacgaagtgccgtttacattccacacctctgtgctcggcggacaa
actgaacaggaagccgcggcagcgtttatccagccgtttgacctcagccaagctccgctg
tttcgagtggggatcgtcaaggtaccagacgggcggcatctattactggtcgatatgcat
cacattatttcagacggtgtgtcagtcaatacgctcattcgggaattcggggagctgtac
gccaatcaggagcttcctccgcttcacattcaatataaagactatgccgtatggcaggag
gcctttaaaaaaggagacacgtacaagacgcaggaggcgtactggctgaagcagctcgaa
ggcgagctgcccgtactggacctgccggctgattacgcccggccgccggtgcgaagcttc
gcgggtgatcaagtctcatttacgctcgatcaagaactcacagccgggcttcacaagctc
gcacggaagaacggaagcaccctgtacatggtgctcctggcagcttacacagcattattg
tcgcgcttaagcggacaggaagacatcatcgtcgggtcaccaattgccggacgtcctcac
aaagatcttgagccgatacttggaatgttcgtcaatacgctggcgcttcggacacgcccg
gagggcgggaagccatttgcgcaatttttgcaggaagtgcgtgagaccgcattggaagct
tacgaacatcaggattatccgttcgaagagcttgtcgacaagctcggcatgacgagggat
atgagccgaaatccgctgtttgatgtgatgtttgtgcttcagaatatggaccaagaatcc
atgcagctgaaggacctgtgtctccggcccgcaacaaatgtggaacatcaagtatcaaag
ttcgatttaaccctgtatgcgtacgaggaagctaatggatctatgatgtttcaaatggaa
tatagcactgatctctatcagaaaaatacgattgaaatgtggcttcaatatttaatgaat
atgctacgcgccatcatccaagacagcgaagcagcacttggaacaatacatgtattggac
gagaatgaaacccatttccttatccatgaactcaactgcacaaaaagagagtatccgaga
catgaaaccatcagcaggctgtttgagttacaggctgcacaaacgcctgatgccatagct
gtggccggcgatgaacaaacattaacgtataaggagctgaacatccgggcaaacaggatt
gctgctgttcttcggagaaaaggagtcggacctgaaactgtagttgcattattgacaaca
cgaactccagaacttgcagcaggaatgctcggcattttgaaagctggaggagcctatttg
cctatcgctaaggatcttcctcctgaccgaatatcatatatgctgtcagacagcggtgca
aaaatacttcttcaatctgaaaaagcaaacaatcaacgattagacttagagcttacatgt
gagcaaatcgtcatcgaagagattcaaggacaaggagaaacgaagaactttgaatctcaa
gcagggccacattcactcgcttatatcatctatacctcaggttcaaccggcaaaccgaag
ggtgtcatgattgagcagcgaagtgtgatccgtcttgtcaaaaacagcaattacattgaa
tttacacctggagaccggcttctgctgacttcttcactcggttttgatgtcgttacattt
gaaatactcgggccgctgctaaatggcgctgctttgcatctcacagataaagaaacattt
ctggattcccatcagcttaagagatacatagaacaaaacggaatcaccacaatgtggctg
actgcatctcttttcaaccatttaacagaacagaatgagaaaatattttcccggctcata
aatctgattattggcggagaagctctgtcagccagtcatgtcaatcgaatcaagcaagca
tgcccggaattgtcaatctggaacggatatgggccgactgagaatacaacattttcaact
tgttttcacattgaaaaactgtatgaacattccattccgatcggccggccgattggtaat
tcaaccgcatttatcttaaataaatgggggatgctgcagccgatcggagctgtcggtgaa
ctgtgtgtcggcggagatggtgtggcaagaggctatcttggtcgaccagacctgacgaaa
gagaaatttgtgccaaatccatttgcgcccggcgaacaaatgtaccgtaccggtgatctg
gcacgctggctgccggacggcacaattgaatatgtaggccgtgtcgatgatcaggtaaaa
ataagggggtaccgggttgagctcggtgagattgaatcagcgcttcgtcatatagacggt
gtcaaagaagcagctgtattggcgcgaacaggacaattaggcagcaaggagctttacgcc
tatataagcgtaaaagagggtacagatgctgaacaagtgcgtactcacctttctcaaatg
ctgccaggctatatgatgccggcctatgtgatagaaatggatgctctcccgctcactgcc
aacggaaaattgaaccgaaaagcactgcctgaaccagatattacatctaaacaaacgtac
gtcccgcctcgaaatgaccttgaagaacagcttgcgatcatatggcaggaggttctcggg
acacagaggatcggaatagaagattcgttttttgaactaggcggagattcaattaaggct
cttcaagtatccgcgcgcctcggacgttatgggtggagcttgcatgcaagcgatttattc
cgccatccgaacataaaagatttatcagcagtcatccggaagacagaaagagtaatagac
caaggatctgttcagggagctgtcccatggacacctattcagcattggttcctctctcag
gatatagaagatagacaccattttaaccagtctgtcatgctgtttagtcctgattgtttg
tcggaaaatgcactgcgcgcatcattaaaaaaactggcagagcatcatgatgccctgcgg
atgatttatcgggatgatagcggacaacagatacaaatcaaccaagatattcatgaatcc
aaactgtacagcttaaggatttctgatttttcagatccgggaatcgattgggaaacgagc
attaaagaagaagtggcaaatcttcagcaaagtatcaatctccaacaaggaccattactg
catgccgcttggtttaaaacgctgtccggagattatttatttctcacgattcatcatttg
gtcgttgatggggtatcatggagaattttactggaggacctgtcagcggcatatcatcaa
gcagcttcaggacaggctatacagcttccgcctaaaacagattcctatcaggaatacgca
cggcgaattcaagattatgcccaaagcagcaagctgattcgcgaggaaacgtactggcgg
acggttgaagaggaaaaagcagcggaactgccatacgaaatgccttatatggagaatatg
aacagcagtgtaagggaaacattgcgcttttcactcactgaagcagacaccgcggtcttg
ctgcaaaaggtaaaccacgcttatggcacagatacacaagatattctattgacggcggct
tccttagcgatttgtgactggacagggggcagcaagctccgtatggcaatggagggacac
gggagagaacacattctgccggatttagacatcagccggacggttggctggtttacatcc
atttaccccgtccttattgactttgaaaatcaagcggatgagcttggaaccgcagttaaa
accgtgaaagatacattgggccggataccgaacaaaggggtagggtacggcatgttgaaa
tatcttacacatcccgaacataaaagcatggtgttttcaaaaacacctgaaatcggcttt
aactatttagggcagttcaacgacatagaaagtcaagaccgtttccgcccatccggtctt
gggagcggtaaggacatcactcctacttggaagcgggagcagcttattgagatgagtgcg
atggcagcagaaaatcagcttcattttcagctcagttatccgccggcacggtttcacagg
ggtacaatggagcggctcatcaccatgattgaatgctatttgcgggatattatgaaacac
tgtgctgaaaaacagaacacagaaaagacgctgagcgatttcagcagccaatcattaacg
gcagaggatttggacagtatatccagcttggtggaagatttgtag

DBGET integrated database retrieval system