Butyrivibrio hungatei: bhn_I1248 Help Entry bhn_I1248         CDS       T04542                                  Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism bhu  Butyrivibrio hungatei Pathway bhu01100   Metabolic pathways bhu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bhu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     bhn_I1248    00074 Mycolic acid biosynthesis     bhn_I1248   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     bhn_I1248 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C YgbB DMTF1_N Motif Other DBs NCBI-ProteinID:  AOZ96282 UniProt:  A0A1D9P199 LinkDB All DBs Position I:1439718..1439954 Genome browser AA seq 78 aa AA seqDB search MEFEKMKEVIANVLNVDPEEITMETTFTEDLGADSLDLFQIIMGLEDEFDVQIDPEKTEN ITTVGEAVELLKTALLDK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaattcgaaaagatgaaagaagttattgcaaatgttttaaatgttgatcctgaggag atcacaatggagacaacatttactgaggatcttggtgctgattcacttgatcttttccag atcatcatgggtcttgaggatgagtttgatgtacagattgatcctgagaagactgaaaac atcacaactgttggcgaggcagtagagcttcttaagacagcacttttagataaataa

DBGET integrated database retrieval system