Butyrivibrio hungatei: bhn_I1601 Help Entry bhn_I1601         CDS       T04542                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bhu  Butyrivibrio hungatei Brite KEGG Orthology (KO) [BR:bhu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bhu03032]     bhn_I1601    03036 Chromosome and associated proteins [BR:bhu03036]     bhn_I1601    03400 DNA repair and recombination proteins [BR:bhu03400]     bhn_I1601 DNA replication proteins [BR:bhu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     bhn_I1601 Chromosome and associated proteins [BR:bhu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     bhn_I1601 DNA repair and recombination proteins [BR:bhu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       bhn_I1601 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF3280 HU-DNA_bdg HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2240 SNRNP27 Transposase_21 Motif Other DBs NCBI-ProteinID:  AOZ96634 UniProt:  A0A1D9P2Q2 LinkDB All DBs Position I:complement(1857990..1858268) Genome browser AA seq 92 aa AA seqDB search MNKTELIDAIAKEAGLSKKDAAAALNAFTETVTKELKKKGKVQLVGFGTFETTKRAARTG KNPQTGAAIKIPASVAPKFKAGKALKDLVNKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagaacttatcgatgcaatcgctaaggaggcaggactttcaaagaaggac gctgctgcagcacttaatgctttcacagagacagtaactaaggagcttaagaagaaggga aaggttcagcttgttggtttcggtacattcgagacaacaaagagagctgctagaacaggt aagaatcctcagactggcgctgcaatcaagattcctgcatctgtagcacctaagttcaag gctggtaaggcacttaaggatcttgtaaacaagaagtaa

DBGET integrated database retrieval system