Butyrivibrio hungatei: bhn_II106 Help Entry bhn_II106         CDS       T04542                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bhu  Butyrivibrio hungatei Brite KEGG Orthology (KO) [BR:bhu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bhu03032]     bhn_II106    03036 Chromosome and associated proteins [BR:bhu03036]     bhn_II106    03400 DNA repair and recombination proteins [BR:bhu03400]     bhn_II106 DNA replication proteins [BR:bhu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     bhn_II106 Chromosome and associated proteins [BR:bhu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     bhn_II106 DNA repair and recombination proteins [BR:bhu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       bhn_II106 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AOZ97905 UniProt:  A0A1D9P6Y8 LinkDB All DBs Position pNP144:115501..115782 Genome browser AA seq 93 aa AA seqDB search MNKTELIDAIAKETKLSKKDAGAVLGAFTDVVSKELKKKGKVQLVGFGTFETAKRAARTG KNPQTGASIKIPAATVPKFKAGKALKDVVNNKH NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaacaagacagaacttattgatgctattgcaaaagagactaagctttctaagaaagac gccggggctgtacttggtgctttcacggacgtggtttcaaaggaacttaagaagaagggt aaagttcagcttgttggttttggaacatttgagacagccaagagagctgctagaacaggt aagaatcctcagactggagcatctattaagatcccagctgctactgttcctaagttcaaa gcaggcaaggcgcttaaagatgtagtaaacaataaacattaa

DBGET integrated database retrieval system