Bisgaardia hudsonensis: A6A11_00815 Help Entry A6A11_00815       CDS       T06663                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism bhud  Bisgaardia hudsonensis Pathway bhud00290   Valine, leucine and isoleucine biosynthesis bhud00650   Butanoate metabolism bhud00660   C5-Branched dibasic acid metabolism bhud00770   Pantothenate and CoA biosynthesis bhud01100   Metabolic pathways bhud01110   Biosynthesis of secondary metabolites bhud01210   2-Oxocarboxylic acid metabolism bhud01230   Biosynthesis of amino acids Module bhud_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine bhud_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:bhud00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     A6A11_00815    00660 C5-Branched dibasic acid metabolism     A6A11_00815   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     A6A11_00815   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     A6A11_00815 Enzymes [BR:bhud01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      A6A11_00815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_4 ACT_AHAS_ss Flg_hook DUF6469 ACT_6 Motif Other DBs NCBI-ProteinID:  QLB12260 LinkDB All DBs Position 170733..170951 Genome browser AA seq 72 aa AA seqDB search MTKYELSIIANRRPETLERLLRVVRHRGFEVVTLQTELLEDQIKLQLQVQSTRAIDLLKN QLAKLYDVVTLN NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacaaaatatgaattatcaattattgcgaatagacgacctgaaaccttagaacgttta ttaagagtagttcgtcatcgtggatttgaagtagtaactttacaaacagagttattagaa gatcaaattaagttacaattacaggtgcaaagtacaagagcgattgatttattaaaaaat caattagcaaaattatatgatgtggttacattaaactga

DBGET integrated database retrieval system