Brevibacillus humidisoli: LOK74_08140 Help Entry LOK74_08140       CDS       T08900                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bhui  Brevibacillus humidisoli Pathway bhui01100   Metabolic pathways bhui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bhui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LOK74_08140    00074 Mycolic acid biosynthesis     LOK74_08140   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LOK74_08140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UFJ42444 LinkDB All DBs Position 1631730..1631987 Genome browser AA seq 85 aa AA seqDB search MNREQVEQNVRAILAANGVDVSRATTRSVFGSPELQLNSVQFMKVFVDLENTFQLEIDYT SAVSDDKRTLGSLIDYLYEQTKQRG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaccgggaacaggtagagcaaaacgtacgagcgatcctagcggcaaatggcgtcgat gtttctcgcgcaacgacccgatccgtttttggttcgccggaactgcagctcaattccgtc cagtttatgaaagtgtttgtcgatctggagaatacgtttcaactggagattgactacaca agcgctgtgtccgatgacaagcgtactttgggcagcttgatcgattacctgtatgaacaa accaagcagagaggataa

DBGET integrated database retrieval system