Brevibacillus humidisoli: LOK74_13220
Help
Entry
LOK74_13220 CDS
T08900
Symbol
thrC
Name
(GenBank) threonine synthase
KO
K01733
threonine synthase [EC:
4.2.3.1
]
Organism
bhui
Brevibacillus humidisoli
Pathway
bhui00260
Glycine, serine and threonine metabolism
bhui00750
Vitamin B6 metabolism
bhui01100
Metabolic pathways
bhui01110
Biosynthesis of secondary metabolites
bhui01120
Microbial metabolism in diverse environments
bhui01230
Biosynthesis of amino acids
Module
bhui_M00018
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:
bhui00001
]
09100 Metabolism
09105 Amino acid metabolism
00260 Glycine, serine and threonine metabolism
LOK74_13220 (thrC)
09108 Metabolism of cofactors and vitamins
00750 Vitamin B6 metabolism
LOK74_13220 (thrC)
Enzymes [BR:
bhui01000
]
4. Lyases
4.2 Carbon-oxygen lyases
4.2.3 Acting on phosphates
4.2.3.1 threonine synthase
LOK74_13220 (thrC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PALP
TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID:
UFJ39038
LinkDB
All DBs
Position
complement(2673616..2674716)
Genome browser
AA seq
366 aa
AA seq
DB search
MANLSNVAGHSSRQLGLIDRYRSLLPVTDKTPELTLHEGSTPLIYAPNLSKQFGVELHFK
YEGLNPTGSFKDRGMVMAVAKAVEEGSTTIMCASTGNTSAAAAAYAARAGLRCIVLIPSG
NIALGKLAQAMIYGAEVIAIEGNFDEALRIVREITASEPITLVNSVNPYRIEGQKTAAFE
VCDALGKAPDILAIPVGNAGNITAYWKGFKEYRQAGQIESLPQMFGFQAAGAAPLVHGEP
VPHPETIATAIRIGNPASREGALAALDESNGHIDAVTDEEILEAYKLLASSEGIFCEPAS
AASLAGVIKLRRSGKLPEGRTIACVLTGHGLKDPNIALESVAVEPRTVAANREAVMAMIR
EGHANE
NT seq
1101 nt
NT seq
+upstream
nt +downstream
nt
atggccaacctgtcaaacgttgccggacattcgtcaaggcagttggggctgatcgaccgg
taccgctcgttgttgcccgttaccgacaagacgccggagttgaccttgcatgagggaagc
acgccgctgatttacgctcccaatctctcgaaacaattcggcgtggaacttcactttaaa
tacgaaggtcttaacccaaccggttcttttaaagatcgcgggatggtcatggcggtagca
aaagcggtggaagaaggcagcacgacaatcatgtgcgcctccacagggaacacctcagca
gccgcagctgcctatgcggctcgcgccgggctgcgctgcatcgtgttgattccgagcggc
aatatcgcgcttggcaagctggcgcaggcgatgatctacggtgctgaggtaatcgctatc
gaaggcaattttgacgaagcactgcgcatcgtccgggagatcactgcttccgaaccgatc
acactggtcaattcggttaacccttaccgcatcgagggacagaagacagcagcttttgaa
gtgtgtgatgcgcttggcaaagcccctgacattctggccattccggtgggtaacgcgggc
aatatcacagcgtattggaaagggtttaaagaataccggcaagctgggcagattgaaagc
ctgccgcagatgttcggcttccaggctgcaggtgcggcaccactggttcatggagagccg
gtgccccatccggagacgatcgccactgcgatccgcatcggaaacccagccagccgggaa
ggggctctggcggctttggatgaatcaaacggccacattgacgcggtaacggacgaagag
attctggaagcttacaaactgctggccagttccgaggggattttctgtgaaccggcgtcg
gcagcatctctcgccggcgtgatcaagctacgccgcagcggcaagctgccggaaggacga
accattgcctgcgtcctgaccgggcatggcctgaaagatcctaacatcgctcttgaatcg
gttgcggtggagccacgtacggtggcagccaatcgtgaggcggttatggcgatgatccgg
gaaggacatgcaaatgaataa
DBGET
integrated database retrieval system