Brevibacillus humidisoli: LOK74_19340 Help Entry LOK74_19340       CDS       T08900                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism bhui  Brevibacillus humidisoli Pathway bhui00190   Oxidative phosphorylation bhui01100   Metabolic pathways Module bhui_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:bhui00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     LOK74_19340 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:bhui00194]     LOK74_19340 (atpE) Photosynthesis proteins [BR:bhui00194]  Photosystem and electron transport system   F-type ATPase [OT]    LOK74_19340 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  UFJ40167 LinkDB All DBs Position complement(3956827..3957048) Genome browser AA seq 73 aa AA seqDB search MEGLALAIGVIFGLAALGAAIGNSVVISRTIEGVARQPESRGSLMGLMFLGLGLVEAVPI IAVAVGFLLYTNL NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggaaggattggctttggcaattggcgttatctttggtctcgctgcacttggagcagca atcggaaactctgtcgttatttcccgtaccattgaaggggtagctcgtcaaccggaatct cgcggttcgctgatgggtctgatgttccttggtctcggtctcgtagaggctgtgccgatc atcgcggtagcagtaggtttcctgctctacaccaatctgtaa

DBGET integrated database retrieval system