KEGG   Brevibacillus humidisoli: LOK74_22125
Entry
LOK74_22125       CDS       T08900                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
bhui  Brevibacillus humidisoli
Pathway
bhui03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bhui00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LOK74_22125 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bhui03011]
    LOK74_22125 (rplR)
Ribosome [BR:bhui03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LOK74_22125 (rplR)
  Bacteria
    LOK74_22125 (rplR)
  Archaea
    LOK74_22125 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p RraA-like
Other DBs
NCBI-ProteinID: UFJ40675
LinkDB
Position
4538658..4539020
AA seq 120 aa
MFTKADKNKARKKRQLRIRKRLTGTAVRPRLNVFRSSKHIYAQLIDDASGSTLVSASSLD
KELGLESGSNVDAAAAVGSLIAKRAQEKGYTEVVFDRGGYLYHGRVKALAEAAREAGLQF
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtttacgaaagccgataaaaacaaagcacggaaaaaacgtcaactgcgcattcgcaaa
cgcctgactggaacagcagtgcgcccgcgtttgaacgtattccgttcttcgaaacacatc
tacgctcagttgattgatgatgcatccggcagcacgctggtaagcgcatcttcacttgat
aaggaactgggactggagagcggcagtaatgttgacgctgctgctgcagtaggcagcttg
attgcaaaacgcgcacaggaaaagggatatacggaagtcgtatttgaccgtggtgggtac
ctctatcacggacgtgtcaaagctctggcagaagctgctcgtgaggctggcctgcaattc
taa

DBGET integrated database retrieval system