Bacteroides humanifaecis: JXR92_003115 Help Entry JXR92_003115      CDS       T08258                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bhum  Bacteroides humanifaecis Pathway bhum01100   Metabolic pathways bhum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bhum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JXR92_003115    00074 Mycolic acid biosynthesis     JXR92_003115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JXR92_003115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  UDB44665 LinkDB All DBs Position 792991..793233 Genome browser AA seq 80 aa AA seqDB search MDTQTILNEMSLIFREVLKRENIVLDNETTAQDVEGWDSLTNMQLINKIEKKFNVRFTFR DIVKLKNVGDICHAILTKTN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggatacacagactattttgaatgaaatgagcctcatctttcgggaggtactgaaaaga gagaacattgtacttgacaatgagaccaccgcccaggatgtggaaggatgggattcactg accaacatgcaactgataaacaagatagagaagaaattcaatgtacgcttcaccttcaga gatattgtaaaactcaaaaacgtgggagacatctgccatgccattttaaccaaaaccaac tag

DBGET integrated database retrieval system