Bombus huntii (Hunt bumble bee): 126867357 Help Entry 126867357         CDS       T10446                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bhun  Bombus huntii (Hunt bumble bee) Pathway bhun04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bhun00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     126867357  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bhun04121]     126867357    03400 DNA repair and recombination proteins [BR:bhun03400]     126867357 Ubiquitin system [BR:bhun04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      126867357    Cul5 complex      126867357 DNA repair and recombination proteins [BR:bhun03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      126867357 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  126867357 NCBI-ProteinID:  XP_050477754 LinkDB All DBs Position 7:complement(13154694..13155780) Genome browser AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKIPPVNQQLFNKDNVPMSDSKFLSD YGLTSATAKPQCPALVGLAVRQENGQFEALEMTPFSLPPDLPDVMKSQEANGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctaatgatccgacgaaaaaatatgaccatatttaccgatgccaaggat aataccacagttcttgaacttaaaaaaattatagaaggtatattgaaaataccacctgtg aatcaacagctgttcaataaggacaatgttccaatgtcagatagtaaatttttatctgat tatggactaacatcagcaactgcaaaaccacaatgtcctgcattagtaggattagctgtg cgtcaagaaaatggtcaatttgaagcattagagatgacaccattttcattaccacctgat ttaccagatgttatgaaatctcaagaagccaatggacaagaacagtcaccttga

DBGET integrated database retrieval system