Bombus huntii (Hunt bumble bee): 126871065 Help Entry 126871065         CDS       T10446                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism bhun  Bombus huntii (Hunt bumble bee) Pathway bhun04814   Motor proteins Brite KEGG Orthology (KO) [BR:bhun00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     126871065  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bhun03037]     126871065    04812 Cytoskeleton proteins [BR:bhun04812]     126871065 Cilium and associated proteins [BR:bhun03037]  Motile cilia and associated proteins   Dynein arm    126871065 Cytoskeleton proteins [BR:bhun04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      126871065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  126871065 NCBI-ProteinID:  XP_050485394 LinkDB All DBs Position 11:complement(1246464..1248349) Genome browser AA seq 112 aa AA seqDB search MMEDMQEETQFVVDDVSKIIKEAIEVSIGGNAYQHNKVNQWTSNVVEGCLGNLTKLQKPY KYIVTCTIMQKNGAGLHTASSCYWDNATDGSCTVRWENKTMYCIVSVFGLAI NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgatggaagatatgcaagaagagacccaatttgtggtcgatgatgtaagcaaaattatt aaggaagcgattgaagtatctattgggggaaatgcttatcaacataacaaagtaaatcag tggacctcgaatgttgtcgaaggatgtttggggaatcttacaaaacttcaaaagccatat aaatatatagtgacttgtactataatgcaaaaaaatggagcaggactgcatactgcgagt tcttgctattgggataatgctactgatggtagttgtacagtgcgttgggaaaacaagaca atgtattgtatcgtttctgtatttggtctagcaatttaa

DBGET integrated database retrieval system