Blautia hydrogenotrophica: BLHYD_22010 Help Entry BLHYD_22010       CDS       T09635                                  Name (GenBank) hypothetical protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism bhv  Blautia hydrogenotrophica Pathway bhv03010   Ribosome Brite KEGG Orthology (KO) [BR:bhv00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BLHYD_22010   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BLHYD_22010  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:bhv03011]     BLHYD_22010    04121 Ubiquitin system [BR:bhv04121]     BLHYD_22010   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bhv04147]     BLHYD_22010 Ribosome [BR:bhv03011]  Ribosomal proteins   Eukaryotes    Small subunit     BLHYD_22010   Archaea     BLHYD_22010 Ubiquitin system [BR:bhv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BLHYD_22010 Exosome [BR:bhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BLHYD_22010   Exosomal proteins of colorectal cancer cells    BLHYD_22010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-Sec23_Sec24 zf-LITAF-like Cas12f1-like_TNB DUF1922 Zn_ribbon_recom Motif Other DBs NCBI-ProteinID:  WPX84191 LinkDB All DBs Position complement(2326190..2326369) Genome browser AA seq 59 aa AA seqDB search MDYFKRCPKCGRYMTPHLQYKFGYSYTLWACVCGYSEDVGDTRADNKTTYVGGGASDRT NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atggactattttaagagatgcccgaaatgcgggcggtatatgacgccgcatcttcaatac aaatttggatattcatatacattatgggcttgtgtatgtgggtattcagaagatgttgga gatacaagagcagataacaaaacaacttatgtaggaggtggagcaagtgacagaacataa

DBGET integrated database retrieval system