Bidens hawaiensis: 143533466 Help Entry 143533466         CDS       T11418                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism bhw  Bidens hawaiensis Pathway bhw04016   MAPK signaling pathway - plant bhw04070   Phosphatidylinositol signaling system bhw04075   Plant hormone signal transduction bhw04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:bhw00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     143533466    04070 Phosphatidylinositol signaling system     143533466    04075 Plant hormone signal transduction     143533466  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     143533466  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bhw01009]     143533466   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhw04131]     143533466    03036 Chromosome and associated proteins [BR:bhw03036]     143533466   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bhw04147]     143533466 Protein phosphatases and associated proteins [BR:bhw01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      143533466 Membrane trafficking [BR:bhw04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     143533466 Chromosome and associated proteins [BR:bhw03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      143533466 Exosome [BR:bhw04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    143533466 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH Allatotropin-like_C EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 SAPC2_N UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen EF-hand_EFHB_C Caleosin FCaBP_EF-hand EF-hand_STIM1 SPEF2_C PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  143533466 NCBI-ProteinID:  XP_076884358 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagcttaccgatgatcagatctctgaattcaaggaagccttcagcttgttc gacaaagatggagacggttgcatcaccaccaaggaacttggaactgttatgaggtcactt ggacaaaacccaaccgaagctgaacttcaagatatgatcaacgaggtggatgctgatggc aacgggacgattgatttcccggagtttctcaatctgatggcccgcaagatgaaggacact gattccgaggaggaactcaaggaagcttttagggtctttgataaggaccagaacggtttc atttctgcagccgagctccgccacgtgatgaccaatcttggtgagaagttgaccgatgag gaagttgatgagatgatccgtgaggctgatgtggacggggatggacagatcaactatgag gagtttgttaaagtcatgatggctaagtga

DBGET integrated database retrieval system