Bidens hawaiensis: 143563669 Help Entry 143563669         CDS       T11418                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism bhw  Bidens hawaiensis Pathway bhw03083   Polycomb repressive complex bhw04120   Ubiquitin mediated proteolysis bhw04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bhw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     143563669    04120 Ubiquitin mediated proteolysis     143563669   09126 Chromosome    03083 Polycomb repressive complex     143563669  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhw04131]     143563669    04121 Ubiquitin system [BR:bhw04121]     143563669    03036 Chromosome and associated proteins [BR:bhw03036]     143563669 Membrane trafficking [BR:bhw04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     143563669 Ubiquitin system [BR:bhw04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      143563669    Cul7 complex      143563669 Chromosome and associated proteins [BR:bhw03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      143563669   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      143563669 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ CoV_NSP10 DUF7784 Motif Other DBs NCBI-GeneID:  143563669 NCBI-ProteinID:  XP_076907304 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MSSSKTIVLRRSDGATFEVDEAVALHSLMIKHRIETGGADSTTIDVPEVTGNTLSKVIEY CKKHVEVPNSDDLKSFDAEFVKVDQAVLCHLTKASYYMNIKGLLDLSCKTIADMFKGKTV EQIRETFHIKNDFTPEEEEELRRENPWHLFV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgtcaaagaccatcgtgcttaggagatccgacggtgctacgttcgaggttgat gaggcagtggcgttgcactctctgatgattaaacacaggattgaaacgggcggtgctgat agtaccaccatcgatgttcctgaggttactggcaacacactctcaaaggtcattgaatac tgcaagaagcatgttgaggtaccaaatagcgatgatctgaagtcgttcgatgccgaattt gtgaaggtggatcaggctgttctttgtcatcttacgaaggcttcttactatatgaacatc aagggcctactcgatctgtcctgtaaaacaattgctgacatgttcaaaggcaagaccgtt gaacaaattcgtgagacgttccacatcaagaatgatttcactccagaagaggaagaggaa ttgcgcagggagaatccatggcatttatttgtttaa

DBGET integrated database retrieval system