Bidens hawaiensis: 143577712 Help Entry 143577712         CDS       T11418                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism bhw  Bidens hawaiensis Pathway bhw03018   RNA degradation bhw03040   Spliceosome Brite KEGG Orthology (KO) [BR:bhw00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     143577712   09123 Folding, sorting and degradation    03018 RNA degradation     143577712  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bhw03019]     143577712    03041 Spliceosome [BR:bhw03041]     143577712 Messenger RNA biogenesis [BR:bhw03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      143577712   mRNA degradation factors    5'-3' decay     Lsm complex      143577712 Spliceosome [BR:bhw03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     143577712 SSDB OrthologParalogGFIT Motif Pfam:  LSM RimP_C Motif Other DBs NCBI-GeneID:  143577712 NCBI-ProteinID:  XP_076917586 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MLGGPGLESVVDQLISVITNDGRNIVGILKGFDQATNIILDESHERVYSTKEGVQQHVLG LYIIRGDNISIIGELDEELDASLDLSEVRAQPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgctaggtggcccgggtcttgaatctgttgtcgatcaactcatttcggtcatcacaaat gatggacgaaacatagtgggaattctaaaaggttttgatcaagcaacaaatataattctg gatgaatctcatgaaagagtttattccaccaaggaaggagttcaacaacatgtgttgggt ctttacatcattaggggtgataacataagcattattggggaacttgatgaggaacttgat gcgagtctggatttgtcagaagtgagagcccaacctctgaagcctgttattcactaa

DBGET integrated database retrieval system