Bidens hawaiensis: 143599140 Help Entry 143599140         CDS       T11418                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism bhw  Bidens hawaiensis Pathway bhw03083   Polycomb repressive complex bhw04120   Ubiquitin mediated proteolysis bhw04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bhw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     143599140    04120 Ubiquitin mediated proteolysis     143599140   09126 Chromosome    03083 Polycomb repressive complex     143599140  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhw04131]     143599140    04121 Ubiquitin system [BR:bhw04121]     143599140    03036 Chromosome and associated proteins [BR:bhw03036]     143599140 Membrane trafficking [BR:bhw04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     143599140 Ubiquitin system [BR:bhw04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      143599140    Cul7 complex      143599140 Chromosome and associated proteins [BR:bhw03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      143599140   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      143599140 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 Spore_GerAC BTB Motif Other DBs NCBI-GeneID:  143599140 NCBI-ProteinID:  XP_076933287 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MSSSQKTVVLKSSDGETFEVEEAVALQSQTIKHMIEDDCADSSIPLPNVTGKILAMVIEY CKKHVDSLANENDLKSIDSKVAKQVDDQVITLLDLIQAANYLDIKGLLGHTPTCYILDLT SQTAADMIKDKTFKEVRQIFNVKNDFTPK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcatcgcaaaagaccgtcgtgttgaagagttccgacggagaaaccttcgaggtt gaagaggcagtggcgttgcaatcacaaacaatcaaacacatgatcgaagatgactgtgct gactctagcatcccactcccaaacgtcaccggcaagatcctggccatggttatcgagtac tgtaagaagcatgtggattcattagcaaacgaaaacgatctcaaatccattgattcaaag gttgctaaacaagtagatgatcaagtgatcactctgcttgatctaattcaggctgcaaat tatctcgacatcaaaggcttactcggtcacaccccaacatgttacatactcgacctgacc tctcaaacggcggctgacatgatcaaggacaagacttttaaagaggttcgccagattttc aacgtcaagaatgacttcacccctaagtaa

DBGET integrated database retrieval system