Bidens hawaiensis: 143602823 Help Entry 143602823         CDS       T11418                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism bhw  Bidens hawaiensis Pathway bhw03083   Polycomb repressive complex bhw04120   Ubiquitin mediated proteolysis bhw04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:bhw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     143602823    04120 Ubiquitin mediated proteolysis     143602823   09126 Chromosome    03083 Polycomb repressive complex     143602823  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhw04131]     143602823    04121 Ubiquitin system [BR:bhw04121]     143602823    03036 Chromosome and associated proteins [BR:bhw03036]     143602823 Membrane trafficking [BR:bhw04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     143602823 Ubiquitin system [BR:bhw04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      143602823    Cul7 complex      143602823 Chromosome and associated proteins [BR:bhw03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      143602823   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      143602823 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Msg2_C DUF3231 Motif Other DBs NCBI-GeneID:  143602823 NCBI-ProteinID:  XP_076935924 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSSSKTIVLRSSDGETFEVDEAVAVESQTIKHMIEDGCADTSIPLPNVTSKILSKVIEYC KKHVEAPTTEDYLTEEEIKAFDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcatcatcaaagaccatcgtgttacgaagctccgacggcgagacgttcgaggttgac gaggcggtggccgtggaatcccagacgatcaaacacatgatcgaagacgggtgtgctgac accagcatccctctgcccaacgtcaccagcaagatcctctccaaggtcatcgagtactgc aagaagcatgtcgaggcacccactaccgaagattatctcactgaagaggagattaaagcc tttgatgccgattttgttaaggtggatcaaagcacgctctttgatctcattttggcggct aactatcttaacatcaagagtctcttggatctcacctgccaaacagttgctgatatgatc aagggtaagacacctgaagagatacgtaagacctttaacatcaagaatgatttcacaccg gaagaggaggaagaggtgcgcagggagaatgcatgggcttttgagtaa

DBGET integrated database retrieval system