Bidens hawaiensis: 143603209 Help Entry 143603209         CDS       T11418                                  Name (RefSeq) polyubiquitin 9-like   KO K03873   elongin-B Organism bhw  Bidens hawaiensis Pathway bhw04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bhw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     143603209  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bhw04121]     143603209    03400 DNA repair and recombination proteins [BR:bhw03400]     143603209 Ubiquitin system [BR:bhw04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      143603209    Cul5 complex      143603209 DNA repair and recombination proteins [BR:bhw03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      143603209 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD UBL_UBAC1 Dsc3_N Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  143603209 NCBI-ProteinID:  XP_076936199 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MAMYIRVKRNKTTYFLHCDATEKILDIKQKLHNLIDQPINDQRLILVSTGEVLDDSKTLA DQKVENDAVVALVLRKDDNEFEDVNIVKPDDFYQSRDAETTGSW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcaatgtatattcgtgttaagcgcaataagacaacgtattttctccattgtgatgct actgagaagattctagacattaagcaaaagttgcataacctcattgatcaaccgattaat gatcagcgtctcattttggtatcaactggagaagtgttggatgattcaaagacattggca gatcaaaaggttgaaaatgatgctgttgtggcactcgtcttgcgaaaagacgacaatgaa ttcgaggatgtgaatatagtgaaacctgatgatttttatcagtcccgtgatgcggagact acgggcagttggtaa

DBGET integrated database retrieval system