Bidens hawaiensis: 143635530 Help Entry 143635530         CDS       T11418                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism bhw  Bidens hawaiensis Pathway bhw03018   RNA degradation bhw03040   Spliceosome Brite KEGG Orthology (KO) [BR:bhw00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     143635530   09123 Folding, sorting and degradation    03018 RNA degradation     143635530  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bhw03019]     143635530    03041 Spliceosome [BR:bhw03041]     143635530 Messenger RNA biogenesis [BR:bhw03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      143635530   mRNA degradation factors    5'-3' decay     Lsm complex      143635530 Spliceosome [BR:bhw03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     143635530 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  143635530 NCBI-ProteinID:  XP_076959466 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MLGGPGLESVVDQFISVITNDGRNIVGILKGFDQATNIILDESHERVYSTKEGVQQHVLG LYIIRGDNICIIGELDEELDASLDLSEVRAQPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgctaggtggccccggtcttgaatcggttgttgatcaattcatttcagtcatcacaaat gatggacggaatatagtgggaattctaaaaggttttgatcaagcaactaatataattctg gatgaatctcatgaaagagtttattccaccaaggaaggagttcaacaacatgtgttgggt ctttacatcatcaggggtgataacatatgcattattggggaactcgatgaggaacttgat gcgagtctggatttgtcagaagtgagagctcaacctctgaagcctgttattcactaa

DBGET integrated database retrieval system