Bidens hawaiensis: 143637572 Help Entry 143637572         CDS       T11418                                  Name (RefSeq) ras-related protein RABF1-like   KO K07887   Ras-related protein Rab-5A Organism bhw  Bidens hawaiensis Pathway bhw04144   Endocytosis bhw04145   Phagocytosis bhw04148   Efferocytosis Brite KEGG Orthology (KO) [BR:bhw00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     143637572    04145 Phagocytosis     143637572    04148 Efferocytosis     143637572  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bhw04131]     143637572   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bhw04147]     143637572    04031 GTP-binding proteins [BR:bhw04031]     143637572 Membrane trafficking [BR:bhw04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     143637572  Endosome - Lysosome transport     143637572 Exosome [BR:bhw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    143637572   Exosomal proteins of other body fluids (saliva and urine)    143637572   Exosomal proteins of colorectal cancer cells    143637572   Exosomal proteins of bladder cancer cells    143637572 GTP-binding proteins [BR:bhw04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     143637572 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA AAA_7 AAA_16 TniB MMR_HSR1 Motif Other DBs NCBI-GeneID:  143637572 NCBI-ProteinID:  XP_076961047 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MGCSSSLPDRSAGRVGGLNPVKAADSDAKNLRVKLVLLGDSGVGKTCIVLRFVRGQFDPT SKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYAALAPLYYRGAAVAVIAYDMQHWPH YITELLLKLEYAYVSKKLAFGLVNSFRRD NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgggttgctcctcctcacttccagataggagtgcgggtcgggtaggtggacttaatccg gttaaagctgctgattctgatgccaaaaatctacgtgtcaagctggtgctattaggggac tctggtgttggaaaaacctgcattgttcttcgttttgttcgtggtcagtttgatccgaca tccaaggtgaccgttggagcttcatttttgtcacaaacaatagctttgcaggactcaaca acggttaaatttgaaatctgggacactgctggtcaggagagatatgcagcactggcccca ctatattacagaggtgcagctgttgcagttattgcatatgatatgcagcactggccccac tatattacagaattgttattaaaactcgaatatgcatatgtaagcaagaaactagctttt ggacttgtgaactcgtttcgtagggattag

DBGET integrated database retrieval system