Brachyspira hyodysenteriae WA1: BHWA1_01942 Help Entry BHWA1_01942       CDS       T00865                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bhy  Brachyspira hyodysenteriae WA1 Pathway bhy00020   Citrate cycle (TCA cycle) bhy00720   Other carbon fixation pathways bhy01100   Metabolic pathways bhy01110   Biosynthesis of secondary metabolites bhy01120   Microbial metabolism in diverse environments bhy01200   Carbon metabolism bhy01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bhy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     BHWA1_01942   09102 Energy metabolism    00720 Other carbon fixation pathways     BHWA1_01942 Enzymes [BR:bhy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      BHWA1_01942 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_21 Fer4_2 Fer4_6 Fer4_15 Fer4_9 Fer4_16 Fer4_13 Fer4_22 Fer4_8 Fer4_17 Fer4_11 Fer4_3 Fer4_4 Fer4_18 Fer4_Nqo3 Motif Other DBs NCBI-ProteinID:  ACN84403 UniProt:  A0A3B6VDS6 LinkDB All DBs Position 2240007..2240240 Genome browser AA seq 77 aa AA seqDB search MAKGRVTIDREQCKGCSNCISVCPTKILYLDKENMNSWGYYPAAVTDMEKCIGCANCAMM CPDICITVERLDKEEAK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctaaaggtagagttactattgatagagaacaatgtaaaggatgttctaactgcata tctgtttgtccaactaagatactgtatttagataaagaaaatatgaattcttggggatat tatccagcagccgttactgatatggagaaatgtataggctgtgctaattgtgctatgatg tgtccggatatatgtataacagttgaaaggttagataaagaggaggctaaataa

DBGET integrated database retrieval system