Bordetella hinzii: ACR54_00295 Help Entry ACR54_00295       CDS       T04004                                  Symbol grxC Name (GenBank) Glutaredoxin-3   KO K03676   glutaredoxin 3 Organism bhz  Bordetella hinzii Brite KEGG Orthology (KO) [BR:bhz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bhz03110]     ACR54_00295 (grxC) Chaperones and folding catalysts [BR:bhz03110]  Protein folding catalysts   Protein disulfide isomerase    ACR54_00295 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 GST_N_2 Thioredoxin_2 Thioredoxin_4 Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  AKQ53653 UniProt:  A0AAN1RV83 LinkDB All DBs Position complement(300322..300579) Genome browser AA seq 85 aa AA seqDB search MQKVVMYSKDYCPYCARAEALLRQRGVTDIEKIQIDREPAQRDAMIERTGRRTVPQIFIG DTHVGGCDDLQALDRAGGLLPLLNG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaaaaagttgttatgtatagcaaggactactgtccgtactgcgcccgggcagaggct ttgctgcgccaacgcggggtcaccgacatcgagaaaatccagatcgatcgcgaacccgcc cagcgcgatgccatgatcgagcgcacgggccgccgcacggtgccgcagattttcatcggc gacacccacgtgggtggctgcgacgacctccaggcgctggaccgcgccggtggtctgctt cccttgttaaacggctga

DBGET integrated database retrieval system