Beijerinckia indica: Bind_3488 Help Entry Bind_3488         CDS       T00688                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism bid  Beijerinckia indica Pathway bid01100   Metabolic pathways bid01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bid00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bind_3488    00074 Mycolic acid biosynthesis     Bind_3488   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bind_3488 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF2470 DUF2240 Motif Other DBs NCBI-ProteinID:  ACB97045 UniProt:  B2IFE5 LinkDB All DBs Position complement(3963799..3964077) Genome browser AA seq 92 aa AA seqDB search MEPNVLDQTELVNQILEVIVSEGMVDREKVTLDATIESLDLKSIDIVMILTAIEEKFDVY IPMDAPFHEATDVKSLIDAIAAYIIKEKTKTE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtggagccgaacgttctcgatcaaaccgaactcgtcaatcagattctcgaggtgatcgtc agtgagggaatggtcgatcgtgagaaggtcacgctcgatgccacgatcgaaagcctggat ctgaaatcgattgatatcgtcatgattctcaccgcgatcgaggaaaaattcgacgtctat attcccatggacgcgcctttccacgaagccactgacgtcaaaagtctcattgacgcgatt gccgcctatatcatcaaggaaaagaccaaaacagaatga

DBGET integrated database retrieval system