KEGG   Beijerinckia indica: Bind_3626
Entry
Bind_3626         CDS       T00688                                 
Name
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bid  Beijerinckia indica
Pathway
bid02020  Two-component system
bid02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bid00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bind_3626
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Bind_3626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bid02022]
    Bind_3626
   02035 Bacterial motility proteins [BR:bid02035]
    Bind_3626
Enzymes [BR:bid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bind_3626
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Bind_3626
Two-component system [BR:bid02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Bind_3626
Bacterial motility proteins [BR:bid02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bind_3626
SSDB
Motif
Pfam: CheB_methylest Response_reg
Other DBs
NCBI-ProteinID: ACB97179
UniProt: B2IGA5
LinkDB
Position
4112116..4113198
AA seq 360 aa
MRQIRVLVVDDSVTMRRLISMVLRRDREIDVVGEAGDPFEARQAIKALNPDVVTLDVEMP
NMNGLDFLEKIMRLRPTPVIMVSNLTAQGTAATIKALEIGAFDCIAKPVSGEVDLFGELA
SKVKAAAGATMRQRPQSEPLSRPESFAATREIYHPGGRLVAIGSSTGGVEALITILSGFP
QNCPPTVIAQHMPAGFTRSFAERLNRLCQPQVCEASDGALLEMGRVYLAPGGLCHLEISG
TSLYGSTPWRCRLRPTDPVNGHRPSVDVLFASVAKAAGSNSVGVILTGMGRDGAQGLLAM
RQSGARTFGQDEASSLVYGMPKAAYEIGAVERQVALPRLRAEILRATNLEGEEKCLSPLQ
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgagacagattcgtgtgctcgttgtggatgattccgtgacgatgcggcgcttgatcagc
atggttctgcgtcgcgatcgcgaaatcgatgtcgtcggtgaagccggagatccctttgag
gcgcggcaggcgatcaaagctttgaaccctgacgtggtgacactcgatgtcgaaatgccg
aatatgaacggcctcgactttctcgagaagatcatgcgattgcggccgacgccggtgatc
atggtgtcgaacctgaccgcgcaaggcacggcggccacaatcaaggctctcgaaatcggt
gctttcgattgtatcgcgaagccggtctccggtgaggtggatctgttcggcgaacttgcg
agcaaggtcaaggccgcggctggcgcgacaatgcggcagcggccacagtccgaacctttg
agccggccggagtctttcgcggcgacgcgcgagatctatcatcccggtggccgcctcgtc
gccatcggttcctcgacaggcggcgttgaggccttgatcaccattctgtccggttttccg
caaaattgccctcccacagtcatcgcccagcacatgccggcgggctttacgcgcagcttc
gcggaacggctgaaccgcctttgccagccgcaggtttgcgaagctagcgatggcgcactg
ctggaaatgggccgcgtatatcttgctcccggcgggctgtgccatctcgaaatctctgga
acctctctttacggttcaaccccctggcgctgccgcttgcgtcctaccgatcctgtgaac
gggcatcgtccctcggtcgatgtgttgtttgcttccgttgccaaggcggcaggctccaac
agtgtcggcgtgatcttgaccggcatgggccgtgatggtgctcaaggtctcctcgccatg
cgtcaaagtggggcgcgcacctttggtcaggatgaggccagctccctcgtttatggcatg
cctaaggccgcatacgaaatcggcgccgttgagagacaggtcgccctgccaagactcagg
gccgaaatcctccgcgccaccaatttagaaggagaagaaaaatgcctttcgccgctgcag
tga

DBGET integrated database retrieval system