KEGG   Bacillus infantis: N288_07545
Entry
N288_07545        CDS       T02860                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
bif  Bacillus infantis
Brite
KEGG Orthology (KO) [BR:bif00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bif03000]
    N288_07545
Transcription factors [BR:bif03000]
 Prokaryotic type
  Other transcription factors
   Others
    N288_07545
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: AGX03439
UniProt: U5L6H9
LinkDB
Position
1366151..1367113
AA seq 320 aa
MLRFVKFISPILLLLLVLSSCGQASPRGELKKAGLLVPDTINDQVWGTKGYKGMLKIQSK
FDVDVFYKEGMNSLPVVERAVREYAQKGVNLIFGHGNEYALYFNEISDEYPDIHFVSFNG
DANNENTTSLNFEGYAMGYFAGMLAAEMSETNKVGVMAAFEWQPEVEGFYEGAIYQNEDT
EVEIRYVGEWDNEQRALELLDVMARNHSDVIYPAGDGFNVPVIEKVKELGLYAIGYISDQ
SDLGESTVLTSTIQHVDALYELVAERMNNGELKSGNLSFDFDDGVISLGKYSPDVDPNYR
DELNSSIERYKETGKLPGQS
NT seq 963 nt   +upstreamnt  +downstreamnt
atgctccgttttgtgaaattcataagcccgattctgctgctccttctggtgctgtcgtca
tgcggacaagcttctccccgcggagagctgaagaaagcagggctgctggtgcccgatacg
atcaatgaccaggtctggggcacgaaaggctataaagggatgctgaaaatccagtccaaa
ttcgatgtggatgtattctataaagaaggaatgaactctcttcccgttgttgagcgtgct
gtaagggagtacgcccagaagggggtaaaccttatttttggccacggaaacgagtacgcc
ttatatttcaatgaaatttcggatgaataccctgacatccattttgtcagctttaatggc
gatgccaataatgagaacaccaccagcttgaattttgaagggtatgctatgggttatttt
gcagggatgcttgcggcagaaatgtcagaaaccaataaagttggagtgatggcagccttt
gaatggcagcctgaggtcgagggtttttatgagggagccatctaccagaatgaagataca
gaggtggagatacgctatgtcggagaatgggataatgaacagagggccctggagcttctg
gatgtcatggccaggaatcattctgatgtgatttaccctgccggcgacggctttaatgtg
cctgtgatcgaaaaagtaaaagaactgggtctgtatgcgatcggctatatatccgaccag
tcagacctcggggaatcgaccgtccttacgagtacgatccagcatgtagatgcactttat
gagctggtagctgaaaggatgaataatggggagcttaaatcggggaatctgtcatttgat
tttgatgatggtgtgatttcgcttggaaaatacagcccggatgttgacccaaattatcgg
gatgagctaaactcatctattgaaaggtataaagagacaggcaaattgcctggccaaagt
tga

DBGET integrated database retrieval system