Candidatus Bipolaricaulis sibiricus: BIP78_0078 Help Entry BIP78_0078        CDS       T05809                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism bih  Candidatus Bipolaricaulis sibiricus Pathway bih03430   Mismatch repair Brite KEGG Orthology (KO) [BR:bih00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     BIP78_0078  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:bih03400]     BIP78_0078 Enzymes [BR:bih01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      BIP78_0078 DNA repair and recombination proteins [BR:bih03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      BIP78_0078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF1890 SlyX TelA HAP1_N Motif Other DBs NCBI-ProteinID:  QAA75846 UniProt:  A0A410FS58 LinkDB All DBs Position 74513..74785 Genome browser AA seq 90 aa AA seqDB search MAKDKTVPKEKSYTEAVARLDEILNLIEEGEVDIDALSGLVTEAAELVTLCRQKITAAEV QVREITERLEREVAESEKGQDEVPADEPPF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggccaaagacaagacggttcccaaggagaagtcctacaccgaggcagtggccaggctc gacgagattctgaacctgattgaggaaggtgaagtggacatcgacgccctgtccggcctc gtaaccgaagccgcggagctggtgaccctgtgtcggcagaagatcacggccgccgaggtg caggtccgggagatcacggagcgcctggagcgcgaggtggcggaatcggagaagggtcaa gacgaggttccggcggacgaacctccgttctag

DBGET integrated database retrieval system