Candidatus Bipolaricaulis sibiricus: BIP78_1048 Help Entry BIP78_1048        CDS       T05809                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bih  Candidatus Bipolaricaulis sibiricus Pathway bih01100   Metabolic pathways bih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bih00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BIP78_1048    00074 Mycolic acid biosynthesis     BIP78_1048   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BIP78_1048 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QAA76814 UniProt:  A0A410FUY6 LinkDB All DBs Position complement(1064461..1064721) Genome browser AA seq 86 aa AA seqDB search MSEIADRVREIIAEQLMVDLDEITDEASFVNDLGADSLDTVELIMEFEDEFGIEIPDESA ESISTVGEAIAYIESRVHEKEGTAGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgagattgctgatcgggtacgggagatcatcgccgagcagctgatggtggatctc gacgagatcaccgatgaagcttcctttgtgaacgatcttggtgcggactccctcgacaca gtcgaactgatcatggagttcgaggacgagttcggcattgagatcccggacgagtcggcg gagagcatcagcaccgttggagaggcgatcgcgtacatcgagagccgtgtccacgagaag gaaggaacggcgggggcgtag

DBGET integrated database retrieval system