KEGG   Bombus impatiens (common eastern bumble bee): 105681831
Entry
105681831         CDS       T04362                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105681831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bim00199]
    105681831
Enzymes [BR:bim01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105681831
Cytochrome P450 [BR:bim00199]
 Cytochrome P450, animal type
  CYP306 family
   105681831
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105681831
NCBI-ProteinID: XP_012248619
UniProt: A0A6P3V5A9
LinkDB
Position
Unknown
AA seq 499 aa
MNFIYAIFVLFVSVLVYVFYINRKVRRLPPGPWQLPIVGYLPWIDAEKPHETLTNLARVY
GPICGFRMGSVYTVLLSDPQLIKQTFSKDMSTGRAPLYLTHGIMKGYGLVCAEGERWKDQ
RKFVSNCLRNFGMIKHEGPKREKMEKRISDAANECATALKNRGANGPIDPLNTLHHCMGN
LVNSIVFGKTYKEEDEVWKWLRHLQEEGVKEIGVAGPLNFLPFLRFLPRYGRTIQSIVDG
KEKTHKVYREILEEHRAQIAQASENTDRVESFLAAFDEQMRKENGTKSEFFTEPQLYHLL
ADLFGAGTDTTLTTFRWFLLFMAAHPTEQEKVRSEMDLCLKEGEQPTLDDRIAMPRLEAA
IAEVQRIRTVTPLGIPHGTSEDMRIGDYDVPRGTMIVPMQWAIHTDPAYWQDPLEFRPDR
FLSDDGSFFKPESFLPFQSGKRICVGEELARMILFLFAGRILRAFVISVPPDEIVDLEGD
CGITLVPKPHRLMFVPRHH
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaacttcatttacgcgatattcgttttattcgtttccgttcttgtatacgtcttctat
ataaatcgaaaggtacgtcgtctaccacctggtccttggcaacttccgatcgtcggctat
cttccatggatcgatgcagaaaaaccacacgagactctgacgaatttagccagagtttat
ggtcctatatgtggattccgcatgggttccgtttatactgttttattgtcggatcctcaa
ttaataaagcagaccttctcgaaagatatgtccaccggtagagcacctttgtaccttaca
cacggaattatgaagggatatggtttagtttgcgcggagggagaacggtggaaggatcag
agaaaattcgttagcaattgcttacgaaactttggaatgataaagcacgaaggaccaaag
cgagagaaaatggagaaacgaatatccgatgcagcaaatgaatgtgcaacggcactgaaa
aatcgcggggcaaatggaccgatcgatccattaaatacgcttcatcattgtatgggtaat
cttgttaatagcatcgtatttggaaaaacctataaggaggaagacgaagtttggaaatgg
ctaagacatttgcaagaagaaggagtgaaagaaatcggtgtcgctggaccgctcaacttt
ttaccttttctcagattcttaccacgatacggccgaacgatacaatcgatcgtcgatgga
aaggagaaaacgcataaagtatatcgggaaatactcgaagaacaccgtgcacagatcgcg
caagcatcagaaaatacggatagagtcgagagctttctggcagcattcgacgaacaaatg
aggaaagaaaacggtacaaaatccgagtttttcacagaaccccaactgtaccatttatta
gcagatctttttggtgctggaactgatactactttgaccacctttcgttggtttctctta
ttcatggctgcccatcctacggagcaggaaaaggtacgatcggagatggatctatgtttg
aaggaaggggagcagccgactctagacgatagaatcgctatgcctcgtctcgaggctgct
atagccgaagtgcagaggataaggactgttacaccactcggtattcctcatggaacatca
gaggatatgcggataggtgattacgatgtaccacgcggtaccatgatcgtgccgatgcag
tgggctattcacaccgatcctgcttactggcaagatcctctcgaatttcgacccgacaga
ttcctatccgatgatggaagtttcttcaaaccggaatcgtttctcccatttcaaagtgga
aaacgcatttgcgtgggagaggaactcgctaggatgatactatttctgttcgccgggagg
atactgcgcgcattcgttatatccgtaccaccggacgagatcgtcgatctcgaaggcgat
tgtggcattacgttagttccgaaaccacatcgcttgatgttcgttccacgacatcattaa

DBGET integrated database retrieval system