Bacillus inaquosorum: AN935_08970 Help Entry AN935_08970       CDS       T07179                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism biq  Bacillus inaquosorum Pathway biq02024   Quorum sensing biq03018   RNA degradation Brite KEGG Orthology (KO) [BR:biq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AN935_08970  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AN935_08970  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:biq03019]     AN935_08970    03036 Chromosome and associated proteins [BR:biq03036]     AN935_08970 Messenger RNA biogenesis [BR:biq03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AN935_08970 Chromosome and associated proteins [BR:biq03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AN935_08970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AMA52410 UniProt:  A0A9Q4HS70 LinkDB All DBs Position 1766881..1767102 Genome browser AA seq 73 aa AA seqDB search MKPINIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLESEGKQQLIYKHAIS TFAPQKNVQLELE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaaaccgattaatattcaggatcagtttttgaatcaaatccggaaagaaaatacgtat gtcactgtttttttgctgaatggctttcagttgcgtggccaagtgaaaggctttgataac tttaccgtattgctggaatcggaagggaagcagcagcttatatataaacatgcgatctca acgtttgcgccgcaaaaaaacgtccagcttgaactcgaatag

DBGET integrated database retrieval system