Bos indicus (zebu cattle): 109554336 Help Entry 109554336         CDS       T04792                                  Symbol INS Name (RefSeq) insulin isoform X1   KO K04526   insulin Organism biu  Bos indicus (zebu cattle) Pathway biu04010   MAPK signaling pathway biu04014   Ras signaling pathway biu04015   Rap1 signaling pathway biu04022   cGMP-PKG signaling pathway biu04066   HIF-1 signaling pathway biu04068   FoxO signaling pathway biu04072   Phospholipase D signaling pathway biu04114   Oocyte meiosis biu04140   Autophagy - animal biu04150   mTOR signaling pathway biu04151   PI3K-Akt signaling pathway biu04152   AMPK signaling pathway biu04211   Longevity regulating pathway biu04213   Longevity regulating pathway - multiple species biu04810   Regulation of actin cytoskeleton biu04910   Insulin signaling pathway biu04911   Insulin secretion biu04913   Ovarian steroidogenesis biu04914   Progesterone-mediated oocyte maturation biu04917   Prolactin signaling pathway biu04923   Regulation of lipolysis in adipocytes biu04930   Type II diabetes mellitus biu04931   Insulin resistance biu04932   Non-alcoholic fatty liver disease biu04940   Type I diabetes mellitus biu04950   Maturity onset diabetes of the young biu04960   Aldosterone-regulated sodium reabsorption biu05010   Alzheimer disease biu05215   Prostate cancer biu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109554336 (INS)    04014 Ras signaling pathway     109554336 (INS)    04015 Rap1 signaling pathway     109554336 (INS)    04066 HIF-1 signaling pathway     109554336 (INS)    04068 FoxO signaling pathway     109554336 (INS)    04072 Phospholipase D signaling pathway     109554336 (INS)    04022 cGMP-PKG signaling pathway     109554336 (INS)    04151 PI3K-Akt signaling pathway     109554336 (INS)    04152 AMPK signaling pathway     109554336 (INS)    04150 mTOR signaling pathway     109554336 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109554336 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     109554336 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109554336 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     109554336 (INS)    04910 Insulin signaling pathway     109554336 (INS)    04923 Regulation of lipolysis in adipocytes     109554336 (INS)    04913 Ovarian steroidogenesis     109554336 (INS)    04914 Progesterone-mediated oocyte maturation     109554336 (INS)    04917 Prolactin signaling pathway     109554336 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     109554336 (INS)   09149 Aging    04211 Longevity regulating pathway     109554336 (INS)    04213 Longevity regulating pathway - multiple species     109554336 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     109554336 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     109554336 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     109554336 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     109554336 (INS)    04940 Type I diabetes mellitus     109554336 (INS)    04950 Maturity onset diabetes of the young     109554336 (INS)    04932 Non-alcoholic fatty liver disease     109554336 (INS)    04931 Insulin resistance     109554336 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:biu04052]     109554336 (INS) Cytokines and neuropeptides [BR:biu04052]  Neuropeptides   Neuropeptides (Unclassified)    109554336 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  109554336 NCBI-ProteinID:  XP_019810290 UniProt:  A0A6P5BJQ6 LinkDB All DBs Position 29:51358843..51360070 Genome browser AA seq 149 aa AA seqDB search MTGQVVGSGAIKPAGRSSPPPSGPAAFEAASKQPPLSPGPRSPAMALWTRLAPLLALLAL WAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAGGPGAGG LEGPPQKRGIVEQCCASVCSLYQLENYCN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgacgggccaggtggtgggctcaggggctataaagccggcaggccgcagcagccccccg ccctcaggaccggctgcattcgaggctgccagcaagcagcccccgctgtcgccaggtcct cgcagccccgccatggccctgtggacacgcctggcgcccctgctggccctgctggcgctc tgggcccccgccccggcccgcgccttcgtcaaccagcatctgtgtggctcccacctggtg gaggcgctgtacctggtgtgcggagagcgcggcttcttctacacgcccaaggcccgccgg gaggtggagggcccccaggtgggggcgctggagctggccggaggcccgggcgcgggcggc ctggaggggcccccgcagaagcgtggcatcgtggagcagtgctgtgccagcgtctgctcg ctctaccagctggagaactactgtaactag

DBGET integrated database retrieval system